Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|106470
Gene name
Locationscaffold_8:48769..50692
Strand-
Gene length (bp)1923
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-16 61 311

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 13 438 2.0E-32
sp|O07563|GLCP_BACSU Glucose/mannose transporter GlcP OS=Bacillus subtilis (strain 168) GN=glcP PE=1 SV=1 74 408 4.0E-08

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 56 74 18
2 89 111 22
3 118 137 19
4 141 160 19
5 181 203 22
6 207 229 22
7 267 289 22
8 299 321 22
9 328 346 18
10 350 372 22
11 379 401 22
12 416 438 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|106470
MEQETMSHRKGHAEEHDIEMTRIISQTPKGNTVEDPAVEQEGGDLRTRKQKNSEKIQFAALCWCLFLAGWNDGST
GPLLPRIQDVYHVGFTVVSLIFIFACLGFVSGALANVHLTDRLGFGKTLILGAALQIIAYAMQSSAPPFPVFVMA
YTINGVGGALQDAQANGFVANLRSDSETKMGLLHAAYGAGALASPLIATQFSLLRQWSFHFLVSLGIAISNIIIL
YTVFGFKTQDECLRLLGQEVPEKNEDEQTSFKQILRVKAVHFLAFFILVYVGVEVTIGGWIVTFMLDVRGGGPSS
GYVSSGFFGGLMLGRVLLLWVNKKIGERLVLFLYAFLAIGLELVIWFVPSLIGGAVAVSIVGLLLGPMYPIAMNH
AGRVLPNWLLTGSIGWIAGFGQAGSAALPFITGVISSKHGIRSLQPLLIAMMGCMMVLWYLVPSKRRD*
Coding >AgabiH97|106470
ATGGAACAAGAAACCATGTCGCACCGCAAAGGCCACGCTGAAGAGCATGACATTGAAATGACGAGAATCATCTCT
CAGACACCCAAAGGTAATACAGTCGAAGATCCGGCGGTTGAACAAGAAGGGGGCGACTTGAGGACTAGGAAACAG
AAAAATTCAGAGAAAATCCAGTTTGCAGCTCTGTGCTGGTGTCTCTTCCTTGCCGGATGGAACGATGGATCAACA
GGTCCTTTACTGCCTCGAATACAGGATGTTTATCATGTCGGATTTACCGTCGTATCCTTGATCTTCATATTTGCC
TGCCTCGGCTTTGTTTCTGGTGCTCTCGCAAACGTACATCTCACTGACCGTTTGGGATTTGGCAAGACACTTATT
CTCGGTGCTGCGCTGCAAATCATCGCATATGCAATGCAATCATCAGCTCCACCCTTCCCTGTATTTGTAATGGCG
TATACTATTAATGGCGTTGGCGGTGCTCTCCAGGATGCCCAGGCCAATGGCTTCGTTGCCAACCTTCGAAGCGAC
TCGGAAACCAAGATGGGTCTCCTACATGCTGCTTATGGTGCTGGTGCCCTAGCCTCTCCACTTATCGCGACGCAG
TTTTCATTGCTCCGTCAGTGGTCCTTCCACTTCCTCGTATCCCTCGGCATTGCAATCTCCAACATAATAATCCTC
TATACCGTATTTGGATTTAAAACGCAAGATGAATGCCTCCGGCTCCTTGGACAAGAAGTACCAGAAAAGAACGAA
GATGAACAAACCTCATTCAAACAGATCCTTCGCGTTAAAGCCGTACATTTCCTCGCATTCTTCATTCTTGTCTAC
GTTGGCGTCGAAGTCACCATCGGAGGGTGGATTGTTACATTTATGCTCGACGTCCGTGGTGGCGGACCGTCCTCG
GGCTACGTTTCATCTGGTTTCTTTGGTGGTCTGATGCTTGGTCGAGTCCTCCTACTCTGGGTAAACAAAAAGATC
GGTGAACGCCTCGTCTTATTTCTCTATGCATTCCTTGCCATCGGGCTCGAACTCGTGATTTGGTTTGTTCCTTCC
CTTATCGGAGGAGCAGTCGCCGTCTCCATCGTCGGTCTCCTGCTAGGGCCCATGTATCCCATCGCTATGAATCAT
GCGGGGCGCGTCCTTCCAAACTGGTTACTCACGGGCTCTATTGGTTGGATAGCGGGATTCGGTCAAGCAGGAAGC
GCAGCTCTTCCTTTCATCACTGGTGTAATTTCTTCAAAGCATGGCATTCGGAGTCTCCAACCACTACTGATTGCG
ATGATGGGTTGCATGATGGTCTTGTGGTATCTCGTACCGTCCAAGCGTCGTGATTGA
Transcript >AgabiH97|106470
ATGGAACAAGAAACCATGTCGCACCGCAAAGGCCACGCTGAAGAGCATGACATTGAAATGACGAGAATCATCTCT
CAGACACCCAAAGGTAATACAGTCGAAGATCCGGCGGTTGAACAAGAAGGGGGCGACTTGAGGACTAGGAAACAG
AAAAATTCAGAGAAAATCCAGTTTGCAGCTCTGTGCTGGTGTCTCTTCCTTGCCGGATGGAACGATGGATCAACA
GGTCCTTTACTGCCTCGAATACAGGATGTTTATCATGTCGGATTTACCGTCGTATCCTTGATCTTCATATTTGCC
TGCCTCGGCTTTGTTTCTGGTGCTCTCGCAAACGTACATCTCACTGACCGTTTGGGATTTGGCAAGACACTTATT
CTCGGTGCTGCGCTGCAAATCATCGCATATGCAATGCAATCATCAGCTCCACCCTTCCCTGTATTTGTAATGGCG
TATACTATTAATGGCGTTGGCGGTGCTCTCCAGGATGCCCAGGCCAATGGCTTCGTTGCCAACCTTCGAAGCGAC
TCGGAAACCAAGATGGGTCTCCTACATGCTGCTTATGGTGCTGGTGCCCTAGCCTCTCCACTTATCGCGACGCAG
TTTTCATTGCTCCGTCAGTGGTCCTTCCACTTCCTCGTATCCCTCGGCATTGCAATCTCCAACATAATAATCCTC
TATACCGTATTTGGATTTAAAACGCAAGATGAATGCCTCCGGCTCCTTGGACAAGAAGTACCAGAAAAGAACGAA
GATGAACAAACCTCATTCAAACAGATCCTTCGCGTTAAAGCCGTACATTTCCTCGCATTCTTCATTCTTGTCTAC
GTTGGCGTCGAAGTCACCATCGGAGGGTGGATTGTTACATTTATGCTCGACGTCCGTGGTGGCGGACCGTCCTCG
GGCTACGTTTCATCTGGTTTCTTTGGTGGTCTGATGCTTGGTCGAGTCCTCCTACTCTGGGTAAACAAAAAGATC
GGTGAACGCCTCGTCTTATTTCTCTATGCATTCCTTGCCATCGGGCTCGAACTCGTGATTTGGTTTGTTCCTTCC
CTTATCGGAGGAGCAGTCGCCGTCTCCATCGTCGGTCTCCTGCTAGGGCCCATGTATCCCATCGCTATGAATCAT
GCGGGGCGCGTCCTTCCAAACTGGTTACTCACGGGCTCTATTGGTTGGATAGCGGGATTCGGTCAAGCAGGAAGC
GCAGCTCTTCCTTTCATCACTGGTGTAATTTCTTCAAAGCATGGCATTCGGAGTCTCCAACCACTACTGATTGCG
ATGATGGGTTGCATGATGGTCTTGTGGTATCTCGTACCGTCCAAGCGTCGTGATTGA
Gene >AgabiH97|106470
ATGGAACAAGAAACCATGTCGCACCGCAAAGGCCACGCTGAAGAGCATGACATTGAAATGACGAGAATCATCTCT
CAGACACCCAAAGGTAATACAGTCGAAGATCCGGCGGTTGAACAAGAAGGGGGCGACTTGAGGACTAGGAAACAG
AAAAATTCAGAGAAAATCCAGTTTGCAGCTCTGTGCTGGTGTCTCTTCCTTGCCGGATGGAACGATGGATCAACA
GGTCCTTTACTGCCTCGAATACAGGATGTTTATCATGTGCATCTCACCCAGCCCCGTAACTGCGCGCAACTAACC
GATACACACAGGTCGGATTTACCGTCGTATCCTTGATCTTCATATTTGCCTGCCTCGTCAGTCGCCTCTCGTTTC
TTAATTCTGTTTATCGCCTCACGGGTTACAGGGCTTTGTTTCTGGTGCTCTCGCAAACGTACATCTCACTGACCG
TTTGGGATTTGGCAAGGTTTGTACTCCACTATGCTCACTGGACATGCTTGAGCTCACATATAAATCGAACAGACA
CTTATTCTCGGTAAAATTATTCATGATTACTTTTGGCCCTAATTTAAAACGAAAAAAAACAGGTGCTGCGCTGCA
AATCATCGCATATGCAATGCAATCATCAGCTCCACCCTTCCCTGTATTTGTAATGGCGTATACTATTAATGGCGT
TGGCGGTGCTCTCCAGGTACATAGTATCTTTATAAGGTTATAAGATACCAGCAGCTCACGACAATTTGCGTTATA
GGATGCCCAGGCCAATGGCTTCGTTGCCAACCTTCGAAGCGACTCGGAAACCAAGATGGGTCTCCTACATGCTGC
TTATGGTGACTTACTACGTAATTTCACAGGACAAGCCCGAGCCCTCTGACCAGTCTTTCATAGGTGCTGGTGCCC
TAGCCTCTCCACTTATCGCGACGCAGTTTTCATTGCTCCGTCAGTGGTCCTTCCACTTCCTCGTATCCCTCGGCA
TTGCAATCTCCAACATAATAATCCTCTATACCGTATTTGGATTTAAAACGCAAGATGGTCAGCGCCACCCAACAC
CCCATCTATGTATATTCATGCTTATCTGTTCTCAGAATGCCTCCGGCTCCTTGGACAAGAAGTACCAGAAAAGAA
CGAAGATGAACAAACCTCATTCAAACAGATCCTTCGCGTTAAAGCCGTACATTTCCTCGCATTCTTCATTCTTGT
CTACGTTGGCGTCGAAGTCACCATCGGAGGGTGGATTGTTACATTTATGCTCGACGTCCGTGGTGGCGGACCGTC
CTCGGGCTACGTTTCATCTGGTTTCTTTGGTGGTAAGACATCTCTCCATCCACTCTAGTTTCAACATTCACGCAA
TTCGAAAGGTCTGATGCTTGGTCGAGTCCTCCTACTCTGGGTAAACAAAAAGGTACGCTGTCTCGTGCAAATCAT
TGTTTGACCCCACCTGACGAAATATACCCAGATCGGTGAACGCCTCGTCTTATTTCTCTATGCATTCCTTGCCAT
CGGGTAATTTATGTTGTTATCCCACCAATTCATAGAATAGCCTAACCGTTCTGCCAGGCTCGAACTCGTGATTTG
GTTTGTTCCTTCCCTTATCGGAGGAGCAGTCGCCGTCTCCATCGTCGGTCTCCTGCTAGGGCCCATGTATCCCAT
CGCTATGAATCATGCGGGGCGCGTCCTTCCAAACTGGTTACTCACGGGCTCTATTGGTTGGATAGCGGGATTCGG
TCAAGCAGGAAGCGCAGCTCTTCCTTTCATCACTGGTGTAATTTCTTCAAAGCATGGCATTCGGAGTCTCCAACC
ACTGTGAGTGCTGTCCGTAAAAAATAACTACGCTAATCTGTATTTCCTCTCCTCAGACTGATTGCGATGATGGGT
TGCATGATGGTCTTGTGGTATCTCGTACCGTCCAAGCGTCGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail