Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|106410
Gene name
Locationscaffold_8:37279..41330
Strand-
Gene length (bp)4051
Transcript length (bp)3429
Coding sequence length (bp)3429
Protein length (aa) 1143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17120 zf-RING_16 RING/Ubox like zinc-binding domain 1.2E-06 1034 1070

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 45 311 9.0E-18
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 33 317 1.0E-17
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 44 311 3.0E-17
sp|O14186|YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.11 PE=3 SV=1 45 302 2.0E-16
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 44 301 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 45 311 9.0E-18
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 33 317 1.0E-17
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 44 311 3.0E-17
sp|O14186|YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.11 PE=3 SV=1 45 302 2.0E-16
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 44 301 2.0E-15
sp|C5DJV1|RTC1_LACTC Restriction of telomere capping protein 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RTC1 PE=3 SV=1 921 1078 2.0E-13
sp|Q5ZMV9|WDR24_CHICK WD repeat-containing protein 24 OS=Gallus gallus GN=WDR24 PE=2 SV=1 96 311 3.0E-13
sp|Q5ZMV9|WDR24_CHICK WD repeat-containing protein 24 OS=Gallus gallus GN=WDR24 PE=2 SV=1 923 1060 2.0E-12
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 923 1078 3.0E-11
sp|Q96S15|WDR24_HUMAN WD repeat-containing protein 24 OS=Homo sapiens GN=WDR24 PE=1 SV=1 911 1060 5.0E-11
sp|C5MIB1|RTC1_CANTT Restriction of telomere capping protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RTC1 PE=3 SV=1 46 469 6.0E-11
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 911 1060 8.0E-11
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 923 1060 1.0E-10
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 911 1060 2.0E-10
sp|A7TR10|RTC1_VANPO Restriction of telomere capping protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RTC1 PE=3 SV=1 923 1078 4.0E-10
sp|Q6CME1|RTC1_KLULA Restriction of telomere capping protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RTC1 PE=3 SV=1 923 1073 2.0E-09
sp|Q75AV6|RTC1_ASHGO Restriction of telomere capping protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RTC1 PE=3 SV=2 921 1078 4.0E-09
sp|C5MIB1|RTC1_CANTT Restriction of telomere capping protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RTC1 PE=3 SV=1 913 1077 5.0E-09
sp|Q6FVJ1|RTC1_CANGA Restriction of telomere capping protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RTC1 PE=3 SV=1 886 1078 1.0E-08
sp|C5DSV0|RTC1_ZYGRC Restriction of telomere capping protein 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RTC1 PE=3 SV=1 923 1077 6.0E-08
sp|Q5ACL4|RTC1_CANAL Restriction of telomere capping protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RTC1 PE=3 SV=1 46 299 7.0E-08
sp|C4YN69|RTC1_CANAW Restriction of telomere capping protein 1 OS=Candida albicans (strain WO-1) GN=RTC1 PE=3 SV=1 46 299 7.0E-08
sp|Q6BXX5|RTC1_DEBHA Restriction of telomere capping protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RTC1 PE=3 SV=2 35 499 1.0E-07
sp|Q6BXX5|RTC1_DEBHA Restriction of telomere capping protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RTC1 PE=3 SV=2 923 1077 2.0E-07
sp|B9WN49|RTC1_CANDC Restriction of telomere capping protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RTC1 PE=3 SV=1 46 299 2.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 96 287 7.0E-07
sp|A5E6M3|RTC1_LODEL Restriction of telomere capping protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RTC1 PE=3 SV=1 923 1077 2.0E-06
sp|A3GIA4|RTC1_PICST Restriction of telomere capping protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RTC1 PE=3 SV=2 45 299 7.0E-06
sp|B9WN49|RTC1_CANDC Restriction of telomere capping protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RTC1 PE=3 SV=1 923 1077 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|106410
MSFSNPFDVYSDSRTHPHPGPSRNARLAKVTLPGGGLISKGEDGRIAVAGRESLRILRISDTSRKIESSRNLWDG
SGLKIDCASTDVAWAYGAFNNKILTSARNGELIVWDLNRSGHSKYERKTKEHLRSIHALSVSRVAHHYCITGSAD
ADFRIWDLRDTQSSVMRVHNPSAVRRVIFSPCTWNPLFVLVGMDNGTIHRWDLKMGQRGLLDRLPVAHMAPITSL
DWYSGGEVTSHAISISSPQPSDDYTGNTLGWVASAGWDRCVKVWNLTGPEVASHMPNKPTYTLHTSYPIRRVLWR
PGFECELAVVSHADFTVSSSHVDHLRSTPSSTALASGFQSRVSSGLGLDAVFKGLSELKPTPKECQPVPHNPSPV
LDAVEIWDVRRSWIPKWSVTGTSAEGGVTAIEFADPHSLLAQNTNGTFTQVDLRDASKPLDAISRASTTWTPDDS
FAFVTDNIFRWEIPYDDIHPDRLGQEISVPKSSLKQIGDPSFRPTTQKFGAFSSAEAHLNADAFRQLASSYIING
DDLPDLCMKNMQAALAAGKPHVAQMWMLMSTTLTERVPSLPPTPPQSPPPQRVTSLTRLSRQAITTPRQPLPAYK
FPPSASASRSPDVPRSRGSPRQLPIAFERSSKFAHRSPSLSKQRSPLSSNSSSPLHHAVNLPPVTPRRTSFFSRR
ESLDSGGSARRSVLLRRQSVPTSAHSASPIDKNSAGVRNAGEGVLSDSDSSTEDTVESCGEEEDTVGALSTDEER
GEEDTFSLPVPPTPSPLSTIVQEQYWTDPEEEDEASPSPKSSDTESGNDSNSTRRKPYINKTRRLPSSRVKTRSR
SSTLASLPAPSRLNSISARSQSRVTPSGANDRQPAQPLPEVGKDSEMAARDTSSRYRGKPKQDANDALLPAKTSK
VIARREDIVVLHESRMLEYGWDVLRQAFEEFVITGDVQTAATMAVIAPEQLKISLRRRLHIYDAYIDQLQKFQLY
TTAAYFRKHSKVQQIRNMTLIDTTIYTTCGRCRKPLIRPAGRSKWKGPTYSYCIGCKTSTVICSICRLPVRTMLF
QCSICHHGGHQSCYRQFYLNQPLVDLPSSRALNEQCSRSPAKMLSDQQFDAKDSDVQNPQRQLQTEPFSFRRTLA
GHPCAGGCGHFCWATWK*
Coding >AgabiH97|106410
ATGTCTTTCAGCAACCCGTTTGATGTCTACTCAGACTCGCGCACCCATCCCCACCCTGGCCCTTCCCGCAACGCC
CGCCTCGCAAAAGTCACCTTGCCCGGCGGTGGACTGATTTCAAAGGGCGAGGATGGCAGAATAGCAGTAGCAGGC
AGAGAATCTCTCAGAATTCTCCGCATCTCCGACACGTCTCGCAAGATTGAGTCGTCGAGAAATCTATGGGATGGC
AGTGGACTTAAGATCGACTGCGCCAGCACAGATGTGGCCTGGGCTTATGGAGCCTTCAACAACAAGATCCTCACC
AGTGCTCGCAACGGAGAACTCATCGTCTGGGATCTCAATAGGTCTGGTCACTCAAAATATGAACGCAAAACTAAG
GAGCATCTGCGCTCCATTCACGCCTTGTCGGTCTCACGCGTCGCGCACCACTACTGCATAACTGGTTCTGCAGAT
GCAGACTTTCGCATCTGGGACCTCCGCGATACTCAATCTTCCGTCATGCGCGTCCATAACCCCTCCGCCGTTCGC
CGTGTCATCTTTTCTCCCTGTACATGGAACCCTCTCTTCGTCCTAGTTGGTATGGACAATGGCACCATCCACCGC
TGGGACCTCAAGATGGGCCAACGGGGCCTCCTCGATCGTCTCCCTGTCGCTCATATGGCCCCCATCACCTCCCTG
GATTGGTATAGCGGAGGAGAAGTGACGTCTCATGCCATCTCCATCTCCAGTCCTCAACCTTCGGACGATTACACC
GGAAATACCCTCGGATGGGTCGCAAGCGCAGGTTGGGATCGCTGTGTCAAAGTTTGGAATCTCACCGGTCCAGAA
GTTGCGTCTCACATGCCGAATAAACCTACGTACACCCTCCACACATCGTATCCCATCCGCCGCGTCCTCTGGCGT
CCCGGCTTCGAATGCGAATTGGCTGTCGTATCCCACGCGGATTTCACTGTGTCTTCCTCTCACGTCGATCATCTT
CGTTCCACTCCGTCCTCGACTGCTTTGGCCAGTGGTTTCCAAAGTCGTGTCAGTAGCGGACTCGGCCTCGACGCT
GTCTTCAAGGGCTTGAGTGAACTCAAGCCGACGCCAAAGGAATGCCAACCTGTTCCACATAACCCTAGCCCAGTT
CTCGATGCTGTAGAAATTTGGGACGTAAGGAGAAGTTGGATCCCCAAGTGGTCTGTCACCGGCACATCAGCTGAA
GGGGGTGTCACTGCTATCGAATTCGCCGACCCTCATAGCTTGCTCGCTCAAAATACAAATGGGACATTCACCCAG
GTCGACTTGAGGGACGCTTCAAAACCTCTGGACGCTATTTCTAGGGCTTCTACAACGTGGACTCCAGACGATTCA
TTCGCTTTTGTTACAGACAATATTTTTCGTTGGGAAATACCATATGACGACATACACCCCGACAGACTTGGCCAG
GAGATCTCCGTTCCCAAATCATCTCTCAAGCAAATCGGTGATCCTTCCTTCCGCCCCACAACGCAGAAATTTGGT
GCATTCTCTTCAGCCGAAGCACACCTCAACGCGGACGCTTTCAGGCAATTAGCATCTTCGTATATCATCAATGGG
GACGATCTACCTGACTTGTGCATGAAAAACATGCAGGCCGCTCTTGCTGCTGGAAAACCGCACGTTGCGCAAATG
TGGATGCTCATGAGCACAACGTTGACAGAACGCGTACCAAGTCTTCCTCCGACACCTCCACAATCGCCACCACCT
CAACGAGTCACTTCTTTGACTCGCCTTTCTCGTCAAGCCATAACAACTCCAAGACAGCCATTGCCAGCATACAAA
TTCCCTCCTTCCGCGTCTGCATCTCGGTCGCCCGACGTGCCGAGATCTCGAGGTAGTCCGCGTCAGCTTCCCATC
GCTTTCGAACGTTCATCCAAGTTTGCTCACCGGAGCCCGTCTTTATCAAAACAGCGGTCCCCGCTTTCTTCAAAT
TCCTCTTCTCCACTGCATCATGCTGTAAACCTTCCCCCAGTCACTCCTCGACGTACAAGCTTCTTCAGTCGTCGA
GAATCCCTGGATTCGGGTGGTTCGGCACGACGTTCCGTTCTTTTGAGAAGGCAATCGGTTCCTACGTCCGCTCAT
AGTGCAAGTCCCATCGATAAGAATTCTGCTGGCGTCAGAAACGCTGGTGAAGGTGTTCTTAGTGACTCTGATTCT
TCTACTGAGGACACTGTCGAGAGCTGTGGGGAAGAAGAGGACACTGTTGGTGCTCTGTCTACAGATGAGGAAAGG
GGAGAAGAAGACACTTTCTCTTTGCCTGTTCCTCCAACACCGAGTCCATTGTCTACGATAGTTCAAGAACAGTAT
TGGACAGATCCAGAAGAGGAAGACGAAGCTTCTCCATCTCCTAAATCCAGTGATACAGAATCAGGGAATGATTCG
AATTCAACCCGAAGAAAACCTTATATCAATAAAACAAGGCGTCTTCCATCATCTCGTGTAAAAACTCGTTCTCGA
AGTTCAACCTTGGCTTCACTTCCAGCTCCATCGAGATTAAATTCCATCTCGGCCCGTTCTCAAAGTCGTGTGACG
CCGAGTGGGGCTAATGACCGGCAGCCCGCTCAGCCTCTTCCAGAAGTTGGGAAAGACTCGGAAATGGCGGCGCGT
GATACTTCGAGTCGGTATCGCGGTAAACCAAAACAAGATGCGAACGACGCGTTGCTTCCTGCCAAGACTTCCAAG
GTGATAGCCCGTCGAGAAGATATCGTTGTTCTACACGAAAGTCGCATGTTGGAGTACGGTTGGGACGTGTTACGT
CAAGCGTTTGAAGAGTTTGTAATCACTGGCGACGTCCAAACTGCTGCTACTATGGCTGTTATTGCGCCCGAACAG
CTGAAGATTTCTCTCCGGAGACGACTTCATATCTATGATGCCTACATAGATCAACTGCAGAAGTTCCAGCTTTAC
ACGACCGCAGCGTATTTCCGCAAACACTCCAAAGTCCAGCAAATCAGAAATATGACTCTCATTGATACTACGATA
TATACCACTTGTGGAAGATGCAGAAAACCACTCATCCGACCTGCAGGACGATCTAAATGGAAGGGTCCGACGTAC
AGTTACTGTATCGGTTGTAAAACCTCCACCGTCATCTGCTCAATATGTCGGCTTCCTGTCCGCACCATGCTTTTC
CAATGTTCAATATGCCATCATGGCGGTCATCAATCATGTTATCGACAATTTTACTTGAATCAACCCTTGGTCGAT
TTACCATCGTCTCGGGCACTTAATGAGCAATGCAGTCGAAGTCCTGCGAAAATGTTATCCGATCAGCAATTCGAT
GCCAAGGATAGTGATGTACAGAATCCTCAGAGGCAGTTGCAGACGGAGCCTTTCTCTTTTAGGAGAACACTGGCC
GGACATCCCTGTGCAGGTGGTTGTGGACATTTTTGTTGGGCAACTTGGAAATGA
Transcript >AgabiH97|106410
ATGTCTTTCAGCAACCCGTTTGATGTCTACTCAGACTCGCGCACCCATCCCCACCCTGGCCCTTCCCGCAACGCC
CGCCTCGCAAAAGTCACCTTGCCCGGCGGTGGACTGATTTCAAAGGGCGAGGATGGCAGAATAGCAGTAGCAGGC
AGAGAATCTCTCAGAATTCTCCGCATCTCCGACACGTCTCGCAAGATTGAGTCGTCGAGAAATCTATGGGATGGC
AGTGGACTTAAGATCGACTGCGCCAGCACAGATGTGGCCTGGGCTTATGGAGCCTTCAACAACAAGATCCTCACC
AGTGCTCGCAACGGAGAACTCATCGTCTGGGATCTCAATAGGTCTGGTCACTCAAAATATGAACGCAAAACTAAG
GAGCATCTGCGCTCCATTCACGCCTTGTCGGTCTCACGCGTCGCGCACCACTACTGCATAACTGGTTCTGCAGAT
GCAGACTTTCGCATCTGGGACCTCCGCGATACTCAATCTTCCGTCATGCGCGTCCATAACCCCTCCGCCGTTCGC
CGTGTCATCTTTTCTCCCTGTACATGGAACCCTCTCTTCGTCCTAGTTGGTATGGACAATGGCACCATCCACCGC
TGGGACCTCAAGATGGGCCAACGGGGCCTCCTCGATCGTCTCCCTGTCGCTCATATGGCCCCCATCACCTCCCTG
GATTGGTATAGCGGAGGAGAAGTGACGTCTCATGCCATCTCCATCTCCAGTCCTCAACCTTCGGACGATTACACC
GGAAATACCCTCGGATGGGTCGCAAGCGCAGGTTGGGATCGCTGTGTCAAAGTTTGGAATCTCACCGGTCCAGAA
GTTGCGTCTCACATGCCGAATAAACCTACGTACACCCTCCACACATCGTATCCCATCCGCCGCGTCCTCTGGCGT
CCCGGCTTCGAATGCGAATTGGCTGTCGTATCCCACGCGGATTTCACTGTGTCTTCCTCTCACGTCGATCATCTT
CGTTCCACTCCGTCCTCGACTGCTTTGGCCAGTGGTTTCCAAAGTCGTGTCAGTAGCGGACTCGGCCTCGACGCT
GTCTTCAAGGGCTTGAGTGAACTCAAGCCGACGCCAAAGGAATGCCAACCTGTTCCACATAACCCTAGCCCAGTT
CTCGATGCTGTAGAAATTTGGGACGTAAGGAGAAGTTGGATCCCCAAGTGGTCTGTCACCGGCACATCAGCTGAA
GGGGGTGTCACTGCTATCGAATTCGCCGACCCTCATAGCTTGCTCGCTCAAAATACAAATGGGACATTCACCCAG
GTCGACTTGAGGGACGCTTCAAAACCTCTGGACGCTATTTCTAGGGCTTCTACAACGTGGACTCCAGACGATTCA
TTCGCTTTTGTTACAGACAATATTTTTCGTTGGGAAATACCATATGACGACATACACCCCGACAGACTTGGCCAG
GAGATCTCCGTTCCCAAATCATCTCTCAAGCAAATCGGTGATCCTTCCTTCCGCCCCACAACGCAGAAATTTGGT
GCATTCTCTTCAGCCGAAGCACACCTCAACGCGGACGCTTTCAGGCAATTAGCATCTTCGTATATCATCAATGGG
GACGATCTACCTGACTTGTGCATGAAAAACATGCAGGCCGCTCTTGCTGCTGGAAAACCGCACGTTGCGCAAATG
TGGATGCTCATGAGCACAACGTTGACAGAACGCGTACCAAGTCTTCCTCCGACACCTCCACAATCGCCACCACCT
CAACGAGTCACTTCTTTGACTCGCCTTTCTCGTCAAGCCATAACAACTCCAAGACAGCCATTGCCAGCATACAAA
TTCCCTCCTTCCGCGTCTGCATCTCGGTCGCCCGACGTGCCGAGATCTCGAGGTAGTCCGCGTCAGCTTCCCATC
GCTTTCGAACGTTCATCCAAGTTTGCTCACCGGAGCCCGTCTTTATCAAAACAGCGGTCCCCGCTTTCTTCAAAT
TCCTCTTCTCCACTGCATCATGCTGTAAACCTTCCCCCAGTCACTCCTCGACGTACAAGCTTCTTCAGTCGTCGA
GAATCCCTGGATTCGGGTGGTTCGGCACGACGTTCCGTTCTTTTGAGAAGGCAATCGGTTCCTACGTCCGCTCAT
AGTGCAAGTCCCATCGATAAGAATTCTGCTGGCGTCAGAAACGCTGGTGAAGGTGTTCTTAGTGACTCTGATTCT
TCTACTGAGGACACTGTCGAGAGCTGTGGGGAAGAAGAGGACACTGTTGGTGCTCTGTCTACAGATGAGGAAAGG
GGAGAAGAAGACACTTTCTCTTTGCCTGTTCCTCCAACACCGAGTCCATTGTCTACGATAGTTCAAGAACAGTAT
TGGACAGATCCAGAAGAGGAAGACGAAGCTTCTCCATCTCCTAAATCCAGTGATACAGAATCAGGGAATGATTCG
AATTCAACCCGAAGAAAACCTTATATCAATAAAACAAGGCGTCTTCCATCATCTCGTGTAAAAACTCGTTCTCGA
AGTTCAACCTTGGCTTCACTTCCAGCTCCATCGAGATTAAATTCCATCTCGGCCCGTTCTCAAAGTCGTGTGACG
CCGAGTGGGGCTAATGACCGGCAGCCCGCTCAGCCTCTTCCAGAAGTTGGGAAAGACTCGGAAATGGCGGCGCGT
GATACTTCGAGTCGGTATCGCGGTAAACCAAAACAAGATGCGAACGACGCGTTGCTTCCTGCCAAGACTTCCAAG
GTGATAGCCCGTCGAGAAGATATCGTTGTTCTACACGAAAGTCGCATGTTGGAGTACGGTTGGGACGTGTTACGT
CAAGCGTTTGAAGAGTTTGTAATCACTGGCGACGTCCAAACTGCTGCTACTATGGCTGTTATTGCGCCCGAACAG
CTGAAGATTTCTCTCCGGAGACGACTTCATATCTATGATGCCTACATAGATCAACTGCAGAAGTTCCAGCTTTAC
ACGACCGCAGCGTATTTCCGCAAACACTCCAAAGTCCAGCAAATCAGAAATATGACTCTCATTGATACTACGATA
TATACCACTTGTGGAAGATGCAGAAAACCACTCATCCGACCTGCAGGACGATCTAAATGGAAGGGTCCGACGTAC
AGTTACTGTATCGGTTGTAAAACCTCCACCGTCATCTGCTCAATATGTCGGCTTCCTGTCCGCACCATGCTTTTC
CAATGTTCAATATGCCATCATGGCGGTCATCAATCATGTTATCGACAATTTTACTTGAATCAACCCTTGGTCGAT
TTACCATCGTCTCGGGCACTTAATGAGCAATGCAGTCGAAGTCCTGCGAAAATGTTATCCGATCAGCAATTCGAT
GCCAAGGATAGTGATGTACAGAATCCTCAGAGGCAGTTGCAGACGGAGCCTTTCTCTTTTAGGAGAACACTGGCC
GGACATCCCTGTGCAGGTGGTTGTGGACATTTTTGTTGGGCAACTTGGAAATGA
Gene >AgabiH97|106410
ATGTCTTTCAGCAACCCGTTTGATGTCTACTCAGACTCGCGCACCCATCCCCACCCTGGCCCTTCCCGCAACGCC
CGCCTCGCAAAAGTCACCTTGCCCGGCGGTGGACTGATTTCAAAGGGCGAGGATGGCAGAATAGCAGTAGCAGGC
AGAGAATGTGCGCGCGCTTCGACAAATTTTACCTTCTCTGACCTCTGCAATCGCAGCTCTCAGAATTCTCCGCAT
CTCCGACACGTCTCGCAAGATTGAGTCGTCGAGAAATCTATGGGATGGCAGTGGACTTAAGATCGACTGCGCCAG
CACAGATGTGGCCTGGGCTTATGGAGGTGATCAACCACTCTTTCTTTGCCGACCCTCCTCCTCAAACTCTGTATA
GCCTTCAACAACAAGATCCTCACCAGTGCTCGCAACGGAGAACTCATCGTCTGGGATCTCAATAGGTCTGGTCAC
TCAAAATATGGTACGCCTTCTTCACTGCTCTCGTCTACCTCTGCTAAACACCCGCTCTCTAGAACGCAAAACTAA
GGAGCATCTGCGCTCCATTCACGCCTTGTCGGTCTCACGCGTCGCGCACCACTACTGCATAACTGGTTCTGCAGA
TGCAGACTTTCGCATCTGGGTCCGTCCTCTTCTTCTTTCTCTCTCAGCTCTCCATTTCATTCCATCTTCTAGGAC
CTCCGCGATACTCAATCTTCCGTCATGCGCGTCCATAACCCCTCCGCCGTTCGCCGTGTCATCTTTTCTCCCTGT
ACATGGAACCCTCTCTTCGTCCTAGTTGGTATGGACAATGGCACCATCCACCGCTGGGACCTCAAGATGGGCCAA
CGGGGCCTCCTCGATCGTCTCCCTGTCGCTCATATGGCCCCCATCACCTCCCTGGATTGGTATAGCGGAGGAGAA
GTGACGTCTCATGCCATCTCCATCTCCAGTCCTCAACCTTCGGACGATTACACCGGAAATACCCTCGGATGGGTC
GCAAGCGCAGGTTGGGATCGCTGTGTCAAAGTGAATTACGTGCAATCTCACTTCCCTTATTTGCCTAATGGTAAA
TTTGCAGGTTTGGAATCTCACCGGTCCAGAAGTTGCGTCTCACATGCCGAATAAACCTACGTACACCCTCCACAC
ATCGTATCCCATCCGCCGCGTCCTCTGGCGTCCCGGCTTCGAATGCGAATTGGCTGTCGTATCCCACGCGGATTT
CACTGTGTCTTCCTCTCACGTCGATCATCTTCGTTCCACTCCGTCCTCGACTGCTTTGGCCAGTGGTTTCCAAAG
TCGTGTCAGTAGCGGACTCGGCCTCGACGCTGTCTTCAAGGGCTTGAGTGAACTCAAGCCGACGCCAAAGGAATG
CCAACCTGTTCCACATAACCCTAGCCCAGTTCTCGATGCTGTAGAAATTTGGGACGTAAGGAGAAGTTGGATCCC
CAAGTGGTCTGTCACCGGCACATCAGCTGAAGGGGGTGTCACTGGTGAGTCGAATCATGTAAAAAACTGCGCCTC
GCTCATCTACTTTAGCTATCGAATTCGCCGACCCTCATAGCTTGCTCGCTCAAAATACAAATGGGACATTCACCC
AGGTCGACTTGAGGGACGCTTCAAAACCTCTGGACGCTATTTCTAGGGCTTCTACAACGTGGACTCCAGACGATT
CATTCGCTTTTGTTACAGACAATATTTTTCGTTGGGAAATACCATATGACGACATGTATGTACCTCTCCAGTGCT
GAAGTGCATATATTGATCATAATTATTTCAGACACCCCGACAGACTTGGCCAGGAGATCTCCGTTCCCAAATCAT
CTCTCAAGCAAATCGGTGATCCTTCCTTCCGCCCCACAACGCAGAAATTTGGTGCATTCTCTTCAGCCGAAGCAC
ACCTCAACGCGGACGCTTTCAGGCAATTAGCATCTTCGTATATCATCAATGGGGACGATCTACCTGACTTGTGCA
TGAAAAACATGCAGGTAAGCGACCACCAACACACCAAAGTTATCCTTCTGACTGGTTTTCTTAGGCCGCTCTTGC
TGCTGGAAAACCGCACGTTGCGCAAATGTGGATGCTCATGAGCACAACGTTGACAGAACGCGTACCAAGTCTTCC
TCCGACACCTCCACAATCGCCACCACCTCAACGAGTCACTTCTTTGACTCGCCTTTCTCGTCAAGCCATAACAAC
TCCAAGACAGCCATTGCCAGCATACAAATTCCCTCCTTCCGCGTCTGCATCTCGGTCGCCCGACGTGCCGAGATC
TCGAGGTAGTCCGCGTCAGCTTCCCATCGCTTTCGAACGTTCATCCAAGTTTGCTCACCGGAGCCCGTCTTTATC
AAAACAGCGGTCCCCGCTTTCTTCAAATTCCTCTTCTCCACTGCATCATGCTGTAAACCTTCCCCCAGTCACTCC
TCGACGTACAAGCTTCTTCAGTCGTCGAGAATCCCTGGATTCGGGTGGTTCGGCACGACGTTCCGTTCTTTTGAG
AAGGCAATCGGTTCCTACGTCCGCTCATAGTGCAAGTCCCATCGATAAGAATTCTGCTGGCGTCAGAAACGCTGG
TGAAGGTGTTCTTAGTGACTCTGATTCTTCTACTGAGGACACTGTCGAGAGCTGTGGGGAAGAAGAGGACACTGT
TGGTGCTCTGTCTACAGATGAGGAAAGGGGAGAAGAAGACACTTTCTCTTTGCCTGTTCCTCCAACACCGAGTCC
ATTGTCTACGATAGTTCAAGAACAGTATTGGACAGATCCAGAAGAGGAAGACGAAGCTTCTCCATCTCCTAAATC
CAGTGATACAGAATCAGGGAATGATTCGAATTCAACCCGAAGAAAACCTTATATCAATAAAACAAGGCGTCTTCC
ATCATCTCGTGTAAAAACTCGTTCTCGAAGTTCAACCTTGGCTTCACTTCCAGCTCCATCGAGATTAAATTCCAT
CTCGGCCCGTTCTCAAAGTCGTGTGACGCCGAGTGGGGCTAATGACCGGCAGCCCGCTCAGCCTCTTCCAGAAGT
TGGGAAAGACTCGGAAATGGCGGCGCGTGATACTTCGAGTCGGTATCGCGGTAAACCAAAACAAGATGCGAACGA
CGCGTTGCTTCCTGCCAAGACTTCCAAGGTGATAGCCCGTCGAGAAGATATCGTTGTTCTACACGAAAGTCGCAT
GTTGGAGTACGGTTGGGACGTGTTACGTCAAGCGTTTGAAGAGTTTGTAATCACTGTGAGTGTTCTTTGAATCTC
TTTTGTTTTCCAATAAAATTAAACACAACACAGGGCGACGTCCAAACTGCTGCTACTATGGCTGTTATTGCGCCC
GAACAGCTGAAGATTTCTCTCCGGAGACGACTTCATATCTATGATGCCTACATAGGTAAGTTTATCCTCGCTTTG
TATGTATCGTTTCGTTCAGATGGATTTGTTAGATCAACTGCAGAAGTTCCAGCTTTACACGACCGCAGCGTATTT
CCGCAAACACTCCAAAGTCCAGCAAATCAGAAATATGACTCTCGTACGCCATTCCCTCTCTTTTAAAGATCTTTT
TTAACCATATAGTTGTTTTATCAGATTGATACTACGATATATACCACTTGTGGAAGATGCAGAAAACCACTCATC
CGACCTGCAGGACGATCTAAATGGAAGGGTCCGACGTACAGTTACTGTATCGGTTGTAAAACCTCCACCGTCATC
TGCTCAATATGGTCAGTCCAACATCCGTTTGCGATATTTTCTCTTGTGTCTCTAATCATGGCGTCATAGTCGGCT
TCCTGTCCGCACCATGCTTTTCCAATGTTCAATATGCCATCATGGCGGTCATCAATCATGTTATCGACAATTTTA
CTTGAATCAACCCTTGGTCGATTTACCATCGTCTCGGGCACTTAATGAGCAATGCAGTCGAAGTCCTGCGAAAAT
GTTATCCGATCAGCAATTCGATGCCAAGGATAGTGATGTACAGAATCCTCAGAGGCAGTTGCAGACGGAGCCTTT
CTCTTTTAGGAGAACACTGGCCGGACATCCCTGTGCAGGTGGTTGTGGACATTTTTGTTGGGCAACTTGGAAATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail