Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|106360
Gene name
Locationscaffold_8:28468..31087
Strand-
Gene length (bp)2619
Transcript length (bp)2571
Coding sequence length (bp)2571
Protein length (aa) 857

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13426 PAS_9 PAS domain 8.4E-15 186 298
PF13426 PAS_9 PAS domain 6.0E-06 409 494
PF00989 PAS PAS fold 5.0E-09 404 471
PF08447 PAS_3 PAS fold 9.7E-06 422 462
PF08448 PAS_4 PAS fold 1.6E-06 405 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 143 573 1.0E-69
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 176 306 3.0E-18
sp|Q1M667|LOVHK_RHIL3 Blue-light-activated histidine kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lov PE=1 SV=1 177 298 6.0E-18
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 176 307 5.0E-17
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 176 307 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 143 573 1.0E-69
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 176 306 3.0E-18
sp|Q1M667|LOVHK_RHIL3 Blue-light-activated histidine kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lov PE=1 SV=1 177 298 6.0E-18
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 176 307 5.0E-17
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 176 307 5.0E-17
sp|Q881J7|LOVHK_PSESM Blue-light-activated protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2896 PE=1 SV=1 177 302 1.0E-16
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 176 306 2.0E-16
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 176 306 6.0E-16
sp|O34627|PHOT_BACSU Blue-light photoreceptor OS=Bacillus subtilis (strain 168) GN=pfyP PE=1 SV=1 178 321 8.0E-16
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 176 298 3.0E-15
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 176 298 3.0E-15
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 176 313 7.0E-15
sp|Q2NCA3|LVHK1_ERYLH Blue-light-activated histidine kinase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_02980 PE=1 SV=1 144 298 7.0E-15
sp|Q2NB77|LVHK2_ERYLH Blue-light-activated histidine kinase 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_04860 PE=1 SV=1 176 305 1.0E-14
sp|Q2NB98|LVHTH_ERYLH Light-activated DNA-binding protein EL222 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_04755 PE=1 SV=1 157 358 2.0E-14
sp|A5VUS1|LOVHK_BRUO2 Blue-light-activated histidine kinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=BOV_A0554 PE=3 SV=2 186 318 2.0E-14
sp|B2SB67|LOVHK_BRUA1 Blue-light-activated histidine kinase OS=Brucella abortus (strain S19) GN=BAbS19_II06090 PE=3 SV=1 186 318 2.0E-14
sp|Q8FW73|LOVHK_BRUSU Blue-light-activated histidine kinase OS=Brucella suis biovar 1 (strain 1330) GN=BRA0588 PE=3 SV=2 186 318 2.0E-14
sp|A9WYQ7|LOVHK_BRUSI Blue-light-activated histidine kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_B0585 PE=3 SV=2 186 318 2.0E-14
sp|Q8YC53|LOVHK_BRUME Blue-light-activated histidine kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0679 PE=1 SV=1 186 318 2.0E-14
sp|A9MBM8|LOVHK_BRUC2 Blue-light-activated histidine kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_B0589 PE=3 SV=2 186 318 2.0E-14
sp|Q577Y7|LOVHK_BRUAB Blue-light-activated histidine kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0636 PE=3 SV=2 186 318 2.0E-14
sp|Q2YKK7|LOVHK_BRUA2 Blue-light-activated histidine kinase OS=Brucella abortus (strain 2308) GN=BAB2_0652 PE=1 SV=2 186 318 2.0E-14
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 148 295 6.0E-14
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 175 301 1.0E-13
sp|Q48IV1|LOVHK_PSE14 Blue-light-activated protein OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_2483 PE=3 SV=2 177 302 1.0E-13
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 176 294 2.0E-13
sp|Q92DM1|PHOT_LISIN Blue-light photoreceptor OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0792 PE=3 SV=1 162 305 2.0E-13
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 148 295 2.0E-13
sp|P58724|PHOT_LISMO Blue-light photoreceptor OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0799 PE=3 SV=1 162 305 5.0E-13
sp|Q4ZSY3|LOVHK_PSEU2 Blue-light-activated protein OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_2700 PE=3 SV=1 177 302 7.0E-13
sp|A6X554|LOVHK_OCHA4 Blue-light-activated histidine kinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_3652 PE=3 SV=1 166 318 8.0E-13
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 175 306 9.0E-13
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 177 368 2.0E-12
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 175 312 3.0E-12
sp|Q9HPU8|BAT_HALSA Bacterioopsin transcriptional activator OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=bat PE=1 SV=1 169 302 2.0E-11
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 175 293 4.0E-11
sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 176 305 4.0E-10
sp|Q9R1T9|KCNH4_RAT Potassium voltage-gated channel subfamily H member 4 OS=Rattus norvegicus GN=Kcnh4 PE=2 SV=1 188 272 2.0E-09
sp|Q9UQ05|KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens GN=KCNH4 PE=2 SV=1 188 272 3.0E-09
sp|O54853|KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus GN=Kcnh6 PE=1 SV=1 177 327 3.0E-09
sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 176 341 1.0E-08
sp|Q9H252|KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens GN=KCNH6 PE=1 SV=1 177 272 2.0E-08
sp|Q9WVJ0|KCNH3_MOUSE Potassium voltage-gated channel subfamily H member 3 OS=Mus musculus GN=Kcnh3 PE=2 SV=2 188 301 7.0E-08
sp|Q9ULD8|KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens GN=KCNH3 PE=1 SV=2 188 301 8.0E-08
sp|O89047|KCNH3_RAT Potassium voltage-gated channel subfamily H member 3 OS=Rattus norvegicus GN=Kcnh3 PE=2 SV=1 188 301 8.0E-08
sp|Q96L42|KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens GN=KCNH8 PE=2 SV=2 188 298 9.0E-07
sp|P59111|KCNH8_MOUSE Potassium voltage-gated channel subfamily H member 8 OS=Mus musculus GN=Kcnh8 PE=2 SV=2 188 298 2.0E-06
sp|Q9QWS8|KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus GN=Kcnh8 PE=2 SV=2 188 298 2.0E-06
sp|O35219|KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus GN=Kcnh2 PE=1 SV=2 177 272 4.0E-06
sp|O08962|KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus GN=Kcnh2 PE=1 SV=1 177 272 4.0E-06
sp|Q12809|KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens GN=KCNH2 PE=1 SV=1 177 272 4.0E-06
sp|Q9TSZ3|KCNH2_CANLF Potassium voltage-gated channel subfamily H member 2 OS=Canis lupus familiaris GN=KCNH2 PE=2 SV=1 177 272 4.0E-06
sp|Q8WNY2|KCNH2_RABIT Potassium voltage-gated channel subfamily H member 2 OS=Oryctolagus cuniculus GN=KCNH2 PE=2 SV=3 177 272 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|106360
MAYNDADNALALHLPSFVCAHAPTLAPGGGAEVIPASLLSDNPLLQSWFSNNGFSIDHQYPPNEQPHRDSARAPQ
SSLSAPFDFDSGLSSASTSNASSSSQLRPLTQSEISALLVPHPTSSLLRQPFFPLSGLAAPSPLNLPVYSASGFD
LLSIMARVANRPHPRVVLGPVDMTCSFVVVDVRRYDHPIVYCSPSFCHLTGYTENQVLGRNCRFLQAPNGHVQRG
DARLYTDPAAVAHLKKNLSADKECQASIINYKKDGTAFVNLVTVIPIAGGVLGGLHEESDVVYHVGFQVDLTEQP
NAILEKLRDGSYIVDYASHTPTPTQQPRHVPLMNFTQTRDRKTQVIPSLRISRDLKKLLSDPAFVKSIPISSSTT
LSLPQSSSTTRPEISLSTVGTNQLFHLMLLEALPDFILVVSLKGSFLYVAPSVRRVLGYEPEEMVGQSISDFAHP
EDVVPLMRELKEGSATGLAAAFTDVSEPNLAPVSDQTPTGMQITPRTVDLLFRARTKHGAYVWIECKGRLHVEPG
KGRKAIVLSGRAKEMPRLKWQSIAYGGGLTIHTQSEDSETEVWGMMSSGQSSGGVVSFTVVGSAMVRVLGWNSSE
LVGRQVVEFIADGASVFLGEIRELCNANAGEGPRRVCCKMRHKNRNLVNTILVLFRPSCDPFAKSIKGVIQAPLI
YQLRSIQSFESNLPTSLVHSLTSDVFDVLDTSRDTSWQYELQQIRFANQRLGEEISSMKKQLEDAKGVEHKVLQD
LQQCHDAQLDHFEVHPDPSSTQFDYHSYLPSRQPEPTPPLETHSIHHHPQGYNNAGSFMPQPEMMVSNGSPMSFS
RGWDASSLYFQNQNKHDSRGLKRSWDVARCG*
Coding >AgabiH97|106360
ATGGCCTACAACGACGCCGACAACGCCCTCGCCCTCCACCTCCCCTCTTTTGTCTGCGCACACGCTCCCACCCTC
GCTCCCGGCGGTGGTGCAGAGGTCATCCCCGCCAGTCTTCTCTCCGACAATCCTCTCCTCCAGTCCTGGTTTTCT
AACAATGGTTTCTCCATCGACCACCAATATCCCCCGAACGAGCAGCCCCACCGCGATTCGGCCCGGGCTCCTCAG
TCCTCTTTGTCTGCTCCATTCGATTTTGATTCTGGGTTGTCTTCTGCGTCTACCTCGAATGCCTCGTCCTCGTCC
CAGCTTCGGCCCCTCACCCAGTCGGAGATCTCGGCTTTGCTCGTCCCCCACCCCACCTCGTCCCTCCTGCGCCAG
CCCTTCTTCCCCCTCTCTGGCCTTGCCGCTCCTTCCCCGTTAAATCTCCCTGTATACTCTGCCTCTGGCTTTGAT
CTTCTGTCTATCATGGCCCGAGTCGCCAATCGCCCTCATCCTCGTGTCGTCCTCGGCCCGGTAGATATGACTTGC
TCTTTCGTCGTAGTTGATGTCCGCAGATACGATCATCCCATCGTATACTGTTCTCCTTCTTTTTGTCATCTCACT
GGCTACACTGAGAACCAAGTCCTCGGCAGGAACTGTCGCTTCCTCCAAGCTCCCAATGGCCATGTGCAACGAGGA
GATGCTCGTCTCTACACGGATCCAGCCGCCGTCGCCCATCTCAAGAAAAACCTTAGTGCGGATAAAGAGTGTCAG
GCTAGTATCATTAATTACAAGAAGGATGGCACTGCCTTTGTGAACCTTGTCACCGTCATCCCCATAGCAGGTGGC
GTTTTGGGTGGGCTCCACGAGGAATCCGACGTTGTTTATCACGTTGGCTTCCAGGTCGACCTCACCGAACAACCA
AACGCTATTCTAGAAAAACTCCGCGATGGTAGTTACATTGTCGACTACGCCTCACACACTCCTACACCAACCCAG
CAACCCCGGCATGTCCCCTTGATGAATTTTACTCAGACCAGGGATAGAAAGACTCAGGTTATTCCTTCTCTCAGA
ATATCGAGAGATCTCAAAAAGTTGCTTTCTGACCCCGCCTTTGTTAAATCAATCCCTATCTCTTCCTCAACTACT
CTCTCTCTCCCGCAGTCATCGTCCACCACCCGCCCGGAGATCTCGTTATCTACCGTTGGAACCAACCAACTCTTC
CATCTCATGCTACTCGAGGCTTTACCCGACTTTATCCTCGTCGTGTCACTCAAGGGGAGTTTTCTTTATGTGGCC
CCTAGCGTTCGCCGAGTCTTGGGGTATGAGCCAGAAGAGATGGTGGGTCAAAGTATTTCAGACTTTGCCCATCCC
GAAGACGTTGTCCCTCTGATGCGCGAACTGAAAGAGGGCAGTGCCACCGGCCTCGCCGCCGCTTTTACGGATGTA
TCTGAGCCAAATCTTGCGCCAGTATCGGATCAGACGCCGACAGGAATGCAGATCACGCCTCGGACTGTCGATCTT
CTTTTCAGGGCACGGACGAAACACGGAGCTTACGTTTGGATTGAATGTAAAGGCCGGTTACATGTCGAACCAGGC
AAAGGCCGGAAAGCCATCGTCCTCAGCGGACGTGCGAAAGAGATGCCTAGACTGAAATGGCAGTCTATTGCTTAC
GGAGGCGGTCTGACCATTCATACTCAATCGGAAGACTCAGAGACGGAAGTATGGGGTATGATGTCAAGTGGACAG
AGCAGTGGTGGCGTTGTCTCCTTTACCGTCGTGGGTTCTGCCATGGTGCGCGTTTTAGGTTGGAATTCTTCGGAA
TTGGTCGGGCGACAGGTCGTCGAATTCATTGCGGATGGCGCAAGTGTTTTTTTGGGCGAGATACGGGAACTGTGC
AACGCCAACGCTGGCGAAGGCCCCAGACGAGTGTGCTGCAAGATGAGGCACAAGAATAGAAACCTCGTGAATACT
ATTCTAGTCCTGTTCCGCCCCAGCTGCGATCCGTTCGCAAAATCCATCAAAGGTGTCATTCAAGCGCCTCTCATT
TACCAGCTTCGCTCCATTCAATCCTTCGAATCTAATCTTCCCACTTCTCTCGTTCATTCTCTGACTTCCGATGTC
TTTGATGTGCTTGACACAAGCCGAGACACGAGCTGGCAGTATGAACTACAGCAGATCCGGTTTGCTAACCAAAGA
TTGGGGGAGGAAATTTCGTCCATGAAGAAGCAGCTTGAAGACGCCAAGGGCGTCGAACACAAAGTCTTGCAGGAT
TTGCAGCAATGCCACGACGCGCAGCTCGACCACTTTGAAGTTCACCCGGATCCTTCTTCAACTCAGTTTGATTAT
CATTCCTATCTGCCTTCTCGACAACCAGAACCCACGCCGCCCCTTGAGACCCATTCCATCCACCACCATCCACAA
GGCTATAATAACGCTGGGTCGTTTATGCCGCAACCGGAGATGATGGTATCAAACGGGTCTCCCATGTCTTTCTCT
CGCGGCTGGGACGCGTCTTCGCTTTACTTCCAGAACCAGAACAAACATGATTCTCGAGGATTGAAACGTTCATGG
GATGTTGCACGTTGTGGTTAA
Transcript >AgabiH97|106360
ATGGCCTACAACGACGCCGACAACGCCCTCGCCCTCCACCTCCCCTCTTTTGTCTGCGCACACGCTCCCACCCTC
GCTCCCGGCGGTGGTGCAGAGGTCATCCCCGCCAGTCTTCTCTCCGACAATCCTCTCCTCCAGTCCTGGTTTTCT
AACAATGGTTTCTCCATCGACCACCAATATCCCCCGAACGAGCAGCCCCACCGCGATTCGGCCCGGGCTCCTCAG
TCCTCTTTGTCTGCTCCATTCGATTTTGATTCTGGGTTGTCTTCTGCGTCTACCTCGAATGCCTCGTCCTCGTCC
CAGCTTCGGCCCCTCACCCAGTCGGAGATCTCGGCTTTGCTCGTCCCCCACCCCACCTCGTCCCTCCTGCGCCAG
CCCTTCTTCCCCCTCTCTGGCCTTGCCGCTCCTTCCCCGTTAAATCTCCCTGTATACTCTGCCTCTGGCTTTGAT
CTTCTGTCTATCATGGCCCGAGTCGCCAATCGCCCTCATCCTCGTGTCGTCCTCGGCCCGGTAGATATGACTTGC
TCTTTCGTCGTAGTTGATGTCCGCAGATACGATCATCCCATCGTATACTGTTCTCCTTCTTTTTGTCATCTCACT
GGCTACACTGAGAACCAAGTCCTCGGCAGGAACTGTCGCTTCCTCCAAGCTCCCAATGGCCATGTGCAACGAGGA
GATGCTCGTCTCTACACGGATCCAGCCGCCGTCGCCCATCTCAAGAAAAACCTTAGTGCGGATAAAGAGTGTCAG
GCTAGTATCATTAATTACAAGAAGGATGGCACTGCCTTTGTGAACCTTGTCACCGTCATCCCCATAGCAGGTGGC
GTTTTGGGTGGGCTCCACGAGGAATCCGACGTTGTTTATCACGTTGGCTTCCAGGTCGACCTCACCGAACAACCA
AACGCTATTCTAGAAAAACTCCGCGATGGTAGTTACATTGTCGACTACGCCTCACACACTCCTACACCAACCCAG
CAACCCCGGCATGTCCCCTTGATGAATTTTACTCAGACCAGGGATAGAAAGACTCAGGTTATTCCTTCTCTCAGA
ATATCGAGAGATCTCAAAAAGTTGCTTTCTGACCCCGCCTTTGTTAAATCAATCCCTATCTCTTCCTCAACTACT
CTCTCTCTCCCGCAGTCATCGTCCACCACCCGCCCGGAGATCTCGTTATCTACCGTTGGAACCAACCAACTCTTC
CATCTCATGCTACTCGAGGCTTTACCCGACTTTATCCTCGTCGTGTCACTCAAGGGGAGTTTTCTTTATGTGGCC
CCTAGCGTTCGCCGAGTCTTGGGGTATGAGCCAGAAGAGATGGTGGGTCAAAGTATTTCAGACTTTGCCCATCCC
GAAGACGTTGTCCCTCTGATGCGCGAACTGAAAGAGGGCAGTGCCACCGGCCTCGCCGCCGCTTTTACGGATGTA
TCTGAGCCAAATCTTGCGCCAGTATCGGATCAGACGCCGACAGGAATGCAGATCACGCCTCGGACTGTCGATCTT
CTTTTCAGGGCACGGACGAAACACGGAGCTTACGTTTGGATTGAATGTAAAGGCCGGTTACATGTCGAACCAGGC
AAAGGCCGGAAAGCCATCGTCCTCAGCGGACGTGCGAAAGAGATGCCTAGACTGAAATGGCAGTCTATTGCTTAC
GGAGGCGGTCTGACCATTCATACTCAATCGGAAGACTCAGAGACGGAAGTATGGGGTATGATGTCAAGTGGACAG
AGCAGTGGTGGCGTTGTCTCCTTTACCGTCGTGGGTTCTGCCATGGTGCGCGTTTTAGGTTGGAATTCTTCGGAA
TTGGTCGGGCGACAGGTCGTCGAATTCATTGCGGATGGCGCAAGTGTTTTTTTGGGCGAGATACGGGAACTGTGC
AACGCCAACGCTGGCGAAGGCCCCAGACGAGTGTGCTGCAAGATGAGGCACAAGAATAGAAACCTCGTGAATACT
ATTCTAGTCCTGTTCCGCCCCAGCTGCGATCCGTTCGCAAAATCCATCAAAGGTGTCATTCAAGCGCCTCTCATT
TACCAGCTTCGCTCCATTCAATCCTTCGAATCTAATCTTCCCACTTCTCTCGTTCATTCTCTGACTTCCGATGTC
TTTGATGTGCTTGACACAAGCCGAGACACGAGCTGGCAGTATGAACTACAGCAGATCCGGTTTGCTAACCAAAGA
TTGGGGGAGGAAATTTCGTCCATGAAGAAGCAGCTTGAAGACGCCAAGGGCGTCGAACACAAAGTCTTGCAGGAT
TTGCAGCAATGCCACGACGCGCAGCTCGACCACTTTGAAGTTCACCCGGATCCTTCTTCAACTCAGTTTGATTAT
CATTCCTATCTGCCTTCTCGACAACCAGAACCCACGCCGCCCCTTGAGACCCATTCCATCCACCACCATCCACAA
GGCTATAATAACGCTGGGTCGTTTATGCCGCAACCGGAGATGATGGTATCAAACGGGTCTCCCATGTCTTTCTCT
CGCGGCTGGGACGCGTCTTCGCTTTACTTCCAGAACCAGAACAAACATGATTCTCGAGGATTGAAACGTTCATGG
GATGTTGCACGTTGTGGTTAA
Gene >AgabiH97|106360
ATGGCCTACAACGACGCCGACAACGCCCTCGCCCTCCACCTCCCCTCTTTTGTCTGCGCACACGCTCCCACCCTC
GCTCCCGGCGGTGGTGCAGAGGTCATCCCCGCCAGTCTTCTCTCCGACAATCCTCTCCTCCAGTCCTGGTTTTCT
AACAATGGTTTCTCCATCGACCACCAGTGCGTGCCTGCTGCTTCTACCCTGTTGTTTTATTTAAATCATCTTAGA
TATCCCCCGAACGAGCAGCCCCACCGCGATTCGGCCCGGGCTCCTCAGTCCTCTTTGTCTGCTCCATTCGATTTT
GATTCTGGGTTGTCTTCTGCGTCTACCTCGAATGCCTCGTCCTCGTCCCAGCTTCGGCCCCTCACCCAGTCGGAG
ATCTCGGCTTTGCTCGTCCCCCACCCCACCTCGTCCCTCCTGCGCCAGCCCTTCTTCCCCCTCTCTGGCCTTGCC
GCTCCTTCCCCGTTAAATCTCCCTGTATACTCTGCCTCTGGCTTTGATCTTCTGTCTATCATGGCCCGAGTCGCC
AATCGCCCTCATCCTCGTGTCGTCCTCGGCCCGGTAGATATGACTTGCTCTTTCGTCGTAGTTGATGTCCGCAGA
TACGATCATCCCATCGTATACTGTTCTCCTTCTTTTTGTCATCTCACTGGCTACACTGAGAACCAAGTCCTCGGC
AGGAACTGTCGCTTCCTCCAAGCTCCCAATGGCCATGTGCAACGAGGAGATGCTCGTCTCTACACGGATCCAGCC
GCCGTCGCCCATCTCAAGAAAAACCTTAGTGCGGATAAAGAGTGTCAGGCTAGTATCATTAATTACAAGAAGGAT
GGCACTGCCTTTGTGAACCTTGTCACCGTCATCCCCATAGCAGGTGGCGTTTTGGGTGGGCTCCACGAGGAATCC
GACGTTGTTTATCACGTTGGCTTCCAGGTCGACCTCACCGAACAACCAAACGCTATTCTAGAAAAACTCCGCGAT
GGTAGTTACATTGTCGACTACGCCTCACACACTCCTACACCAACCCAGCAACCCCGGCATGTCCCCTTGATGAAT
TTTACTCAGACCAGGGATAGAAAGACTCAGGTTATTCCTTCTCTCAGAATATCGAGAGATCTCAAAAAGTTGCTT
TCTGACCCCGCCTTTGTTAAATCAATCCCTATCTCTTCCTCAACTACTCTCTCTCTCCCGCAGTCATCGTCCACC
ACCCGCCCGGAGATCTCGTTATCTACCGTTGGAACCAACCAACTCTTCCATCTCATGCTACTCGAGGCTTTACCC
GACTTTATCCTCGTCGTGTCACTCAAGGGGAGTTTTCTTTATGTGGCCCCTAGCGTTCGCCGAGTCTTGGGGTAT
GAGCCAGAAGAGATGGTGGGTCAAAGTATTTCAGACTTTGCCCATCCCGAAGACGTTGTCCCTCTGATGCGCGAA
CTGAAAGAGGGCAGTGCCACCGGCCTCGCCGCCGCTTTTACGGATGTATCTGAGCCAAATCTTGCGCCAGTATCG
GATCAGACGCCGACAGGAATGCAGATCACGCCTCGGACTGTCGATCTTCTTTTCAGGGCACGGACGAAACACGGA
GCTTACGTTTGGATTGAATGTAAAGGCCGGTTACATGTCGAACCAGGCAAAGGCCGGAAAGCCATCGTCCTCAGC
GGACGTGCGAAAGAGATGCCTAGACTGAAATGGCAGTCTATTGCTTACGGAGGCGGTCTGACCATTCATACTCAA
TCGGAAGACTCAGAGACGGAAGTATGGGGTATGATGTCAAGTGGACAGAGCAGTGGTGGCGTTGTCTCCTTTACC
GTCGTGGGTTCTGCCATGGTGCGCGTTTTAGGTTGGAATTCTTCGGAATTGGTCGGGCGACAGGTCGTCGAATTC
ATTGCGGATGGCGCAAGTGTTTTTTTGGGCGAGATACGGGAACTGTGCAACGCCAACGCTGGCGAAGGCCCCAGA
CGAGTGTGCTGCAAGATGAGGCACAAGAATAGAAACCTCGTGAATACTATTCTAGTCCTGTTCCGCCCCAGCTGC
GATCCGTTCGCAAAATCCATCAAAGGTGTCATTCAAGCGCCTCTCATTTACCAGCTTCGCTCCATTCAATCCTTC
GAATCTAATCTTCCCACTTCTCTCGTTCATTCTCTGACTTCCGATGTCTTTGATGTGCTTGACACAAGCCGAGAC
ACGAGCTGGCAGTATGAACTACAGCAGATCCGGTTTGCTAACCAAAGATTGGGGGAGGAAATTTCGTCCATGAAG
AAGCAGCTTGAAGACGCCAAGGGCGTCGAACACAAAGTCTTGCAGGATTTGCAGCAATGCCACGACGCGCAGCTC
GACCACTTTGAAGTTCACCCGGATCCTTCTTCAACTCAGTTTGATTATCATTCCTATCTGCCTTCTCGACAACCA
GAACCCACGCCGCCCCTTGAGACCCATTCCATCCACCACCATCCACAAGGCTATAATAACGCTGGGTCGTTTATG
CCGCAACCGGAGATGATGGTATCAAACGGGTCTCCCATGTCTTTCTCTCGCGGCTGGGACGCGTCTTCGCTTTAC
TTCCAGAACCAGAACAAACATGATTCTCGAGGATTGAAACGTTCATGGGATGTTGCACGTTGTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail