Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|105950
Gene name
Locationscaffold_7:2254291..2255878
Strand+
Gene length (bp)1587
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O51055|Y024_BORBU Uncharacterized protein BB_0024 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0024 PE=4 SV=1 13 380 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|105950
MRASLFLFLSLPVFILAQIQSDGANFLSPVTVAPGLDASVIFSNLTSPRGVAIDSQQNLLVVERGVGVSAFTRVS
AGWSRTVVIKNDQLTHGIQIDSSTLYVSTASEVLAYSYDPATQVASSQGSALIANLPPDGELTTHTLQLARDNSG
LVTAILVGSGPKTNIDITARDPASGRSQIRSFSLLTKQPWPLNWENGVVVAYGIRNPAGFAFVPSPQVGPVDSQT
LLVVENAPSIDNVTGLTAAFANDNPADEIESVTISATGNTTPASYGFPDCATLWNGAADPTGVPQYKDSPRGTQF
SLNLPSLSTPLPRLDPWCQNMTNNHPPAFNFQAHSVPLDIKRYEPEPIGVGGGLPGEWSGDVFVSFHGSFDRTPP
TGYGVVHVPYPFGSLSTSPLGYDFLVQATDLNTCPGRCIRPAGLVFGRDNRLYVTSDSSGELFVIRGSALSPSSS
TG*
Coding >AgabiH97|105950
ATGAGGGCCTCTTTATTCCTCTTCCTTAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAGTCCGATGGAGCCAAT
TTTCTATCACCAGTGACTGTTGCGCCTGGTCTCGACGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTTGCTATCGACTCTCAACAAAACTTGCTCGTAGTTGAACGTGGAGTTGGAGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCGACTCAAGTGGCTTCGAGCCAAGGGAGC
GCTCTTATCGCGAATTTACCCCCTGACGGAGAGTTGACTACGCATACTCTTCAGTTGGCACGCGATAATTCCGGT
TTGGTGACTGCTATCCTTGTCGGTTCTGGCCCCAAAACCAACATCGATATCACGGCTCGCGATCCCGCCTCCGGT
CGATCTCAAATTCGTTCTTTTTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTC
GCTTATGGGATTCGTAATCCGGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCCGTTGATTCTCAAACC
CTGCTCGTTGTTGAAAATGCCCCTTCCATTGATAACGTGACGGGATTGACTGCAGCCTTTGCAAACGATAATCCT
GCTGATGAAATTGAGAGTGTTACGATATCCGCTACCGGTAACACTACTCCAGCCTCTTATGGATTCCCCGACTGC
GCCACTCTTTGGAATGGTGCAGCTGATCCCACTGGTGTACCACAATACAAAGATTCTCCTCGTGGCACACAGTTC
AGTCTGAATCTACCTTCGTTGTCAACACCACTTCCTCGCCTCGATCCTTGGTGCCAAAATATGACAAACAATCAT
CCCCCGGCTTTCAACTTCCAGGCCCACTCCGTTCCTCTCGATATCAAACGATATGAACCTGAACCCATTGGCGTT
GGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTCTTTCCACGGTTCTTTTGACAGGACTCCTCCT
ACAGGTTACGGTGTAGTCCATGTACCCTACCCATTCGGATCTCTCTCAACTTCCCCCTTGGGCTATGACTTCCTT
GTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTCTTTGGTCGAGATAAT
AGACTGTATGTTACGAGTGATAGTAGCGGAGAGTTGTTTGTTATCCGGGGCTCTGCGTTAAGCCCCTCTTCGAGT
ACCGGCTAG
Transcript >AgabiH97|105950
ATGAGGGCCTCTTTATTCCTCTTCCTTAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAGTCCGATGGAGCCAAT
TTTCTATCACCAGTGACTGTTGCGCCTGGTCTCGACGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTTGCTATCGACTCTCAACAAAACTTGCTCGTAGTTGAACGTGGAGTTGGAGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCGACTCAAGTGGCTTCGAGCCAAGGGAGC
GCTCTTATCGCGAATTTACCCCCTGACGGAGAGTTGACTACGCATACTCTTCAGTTGGCACGCGATAATTCCGGT
TTGGTGACTGCTATCCTTGTCGGTTCTGGCCCCAAAACCAACATCGATATCACGGCTCGCGATCCCGCCTCCGGT
CGATCTCAAATTCGTTCTTTTTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTC
GCTTATGGGATTCGTAATCCGGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCCGTTGATTCTCAAACC
CTGCTCGTTGTTGAAAATGCCCCTTCCATTGATAACGTGACGGGATTGACTGCAGCCTTTGCAAACGATAATCCT
GCTGATGAAATTGAGAGTGTTACGATATCCGCTACCGGTAACACTACTCCAGCCTCTTATGGATTCCCCGACTGC
GCCACTCTTTGGAATGGTGCAGCTGATCCCACTGGTGTACCACAATACAAAGATTCTCCTCGTGGCACACAGTTC
AGTCTGAATCTACCTTCGTTGTCAACACCACTTCCTCGCCTCGATCCTTGGTGCCAAAATATGACAAACAATCAT
CCCCCGGCTTTCAACTTCCAGGCCCACTCCGTTCCTCTCGATATCAAACGATATGAACCTGAACCCATTGGCGTT
GGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTCTTTCCACGGTTCTTTTGACAGGACTCCTCCT
ACAGGTTACGGTGTAGTCCATGTACCCTACCCATTCGGATCTCTCTCAACTTCCCCCTTGGGCTATGACTTCCTT
GTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTCTTTGGTCGAGATAAT
AGACTGTATGTTACGAGTGATAGTAGCGGAGAGTTGTTTGTTATCCGGGGCTCTGCGTTAAGCCCCTCTTCGAGT
ACCGGCTAG
Gene >AgabiH97|105950
ATGAGGGCCTCTTTATTCCTCTTCCTTAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAGTCCGATGGAGCCAAT
TTTCTATCACCAGTGACTGTTGCGCCTGGTCTCGACGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTTGCTATCGACTCTCAACAAAACTTGCTCGTAGTTGAACGTGGAGTTGGAGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCGACTCAAGTGGCTTCGAGCCAAGGGAGC
GCTCTTATCGCGAATTTACCCCCTGACGGAGGTCGGTGTTCAATGATTCAGACTAGCCGAAAACTAATTCATTCT
TCCATCTTCGCAGAGTTGACTACGCATACTCTTCAGTTGGCACGCGATAATTCCGGTTTGGTGACTGCTATCCTT
GTCGGTTCTGGCCCCAAAACCAACATCGATATCACGGCTCGCGATCCCGCCTCCGGTCGATCTCAAATTCGTTCT
TTTTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTCGCTTATGGGATTCGTAAT
CCGGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCCGTTGATTCTCAAACCCTGCTCGTTGTTGAAAAT
GCCCCTTCCATTGATAACGTGACGGGATTGACTGCAGCCTTTGCAAACGATAATCCTGCTGATGAAATTGAGAGT
GTTACGATATCCGCTACCGGTAACACTACTCCAGCCTCTTATGGATTCCCCGACTGCGCCACTCTTTGGAATGGT
GCAGCTGATCCCACTGGTGTACCACAATACAAAGATTCTCCTCGTGGCACACAGTTCAGTCTGAATCTACCTTCG
TTGTCAACACCACTTCCTCGCCTCGATCCTTGGTGCCAAAATATGACAAACAATCATCCCCCGGCTTTCAACTTC
CAGGTAACGATTTATGTATCAAATATTGGATTACATATAACTCTTGATATAGGCCCACTCCGTTCCTCTCGATAT
CAAACGATATGAACCTGAACCCATTGGCGTTGGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTC
TTTCCACGGTTCTTTTGACAGGACTCCTCCTACAGGTTACGGTGTAGTCCAGTACGCTTTCAACTTCTTACAATT
GAAGGATATTGAGCTCATTGATTGATTGACATCAGTGTACCCTACCCATTCGGATCTCTCTCAACTTCCCCCTTG
GGCTATGACTTCCTTGTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTC
TTTGGTCGAGATAATAGACTGTATGTTACGAGTGATAGTAGCGGAGAGGTACGTTTGGTCTCGCGTTGAAGTTTT
GGTCTGATTTTGCTGACATGATGTTAAAAACAATAGTTGTTTGTTATCCGGGGCTCTGCGTTAAGCCCCTCTTCG
AGTACCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail