© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|105890 |
| Gene name | |
| Location | scaffold_7:2244793..2245233 |
| Strand | - |
| Gene length (bp) | 440 |
| Transcript length (bp) | 336 |
| Coding sequence length (bp) | 336 |
| Protein length (aa) | 112 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01185 | Hydrophobin | Fungal hydrophobin | 5.5E-05 | 31 | 103 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P49072|HYP1_AGABI | Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 | 4 | 106 | 3.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005199 | structural constituent of cell wall | Yes |
| GO:0009277 | fungal-type cell wall | Yes |
| GO:0005575 | cellular_component | No |
| GO:0003674 | molecular_function | No |
| GO:0005618 | cell wall | No |
| GO:0030312 | external encapsulating structure | No |
| GO:0005198 | structural molecule activity | No |
| GO:0110165 | cellular anatomical entity | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 20 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 1722.84 | 1012.07 | 2433.60 |
| Initials | Initials knots | 3399.10 | 1852.73 | 4945.47 |
| Pileal_Stipeal_center | Stage I stipe center | 2989.71 | 1582.04 | 4397.38 |
| Pileal_Stipeal_shell | Stage I stipe shell | 2491.45 | 1416.03 | 3566.87 |
| DIF_stipe_center | Stage II stipe center | 2930.71 | 1654.13 | 4207.30 |
| DIF_stipe_shell | Stage II stipe shell | 2559.08 | 1456.49 | 3661.67 |
| DIF_stipe_skin | Stage II stipe skin | 2158.02 | 1245.15 | 3070.89 |
| DIF_cap_skin | Stage II cap skin | 1599.38 | 948.22 | 2250.53 |
| DIF_cap_tissue | Stage II cap tissue | 1092.79 | 653.27 | 1532.32 |
| DIF_gill_tissue | Stage II gill tissue | 1750.79 | 1021.67 | 2479.91 |
| YFB_stipe_center | Young fruiting body stipe center | 2097.77 | 1217.08 | 2978.47 |
| YFB_stipe_shell | Young fruiting body stipe shell | 1704.87 | 1008.26 | 2401.49 |
| YFB_stipe_skin | Young fruiting body stipe skin | 1644.39 | 972.19 | 2316.60 |
| YFB_cap_skin | Young fruiting body cap skin | 1758.25 | 1027.36 | 2489.13 |
| YFB_cap_tissue | Young fruiting body cap tissue | 259.21 | 140.59 | 377.84 |
| YFB_gill_tissue | Young fruiting body gill tissue | 2344.00 | 1345.81 | 3342.18 |
| YFB_veil | Young fruiting body veil | 2415.80 | 1379.71 | 3451.88 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.976915 | no |
| Casing | YFB_stipe_center | 0.612501 | no |
| Casing | YFB_stipe_shell | 0.984964 | no |
| Casing | YFB_stipe_skin | 0.931811 | no |
| Casing | YFB_cap_skin | 0.970292 | no |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.350240 | no |
| Casing | YFB_veil | 0.295435 | no |
| Casing | Initials | 0.013782 | yes |
| Casing | Pileal_Stipeal_center | 0.064141 | no |
| Casing | Pileal_Stipeal_shell | 0.238319 | no |
| Casing | DIF_stipe_center | 0.053565 | no |
| Casing | DIF_stipe_shell | 0.196757 | no |
| Casing | DIF_stipe_skin | 0.541827 | no |
| Casing | DIF_cap_skin | 0.881795 | no |
| Casing | DIF_cap_tissue | 0.102673 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.659249 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.962556 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.905219 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.993329 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.387205 | no |
| DIF_gill_tissue | YFB_veil | 0.332527 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.588747 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.504690 | no |
| YFB_stipe_center | YFB_cap_skin | 0.660458 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.813651 | no |
| YFB_stipe_center | YFB_veil | 0.749874 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.949084 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.955624 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.330826 | no |
| YFB_stipe_shell | YFB_veil | 0.278986 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.895686 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.266541 | no |
| YFB_stipe_skin | YFB_veil | 0.219634 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.399222 | no |
| YFB_cap_skin | YFB_veil | 0.344404 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.957565 | no |
| Initials | DIF_gill_tissue | 0.014956 | yes |
| Initials | YFB_stipe_center | 0.110863 | no |
| Initials | YFB_stipe_shell | 0.011659 | yes |
| Initials | YFB_stipe_skin | 0.008121 | yes |
| Initials | YFB_cap_skin | 0.017226 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.256555 | no |
| Initials | YFB_veil | 0.317790 | no |
| Initials | Pileal_Stipeal_center | 0.800113 | no |
| Initials | Pileal_Stipeal_shell | 0.381968 | no |
| Initials | DIF_stipe_center | 0.744023 | no |
| Initials | DIF_stipe_shell | 0.438005 | no |
| Initials | DIF_stipe_skin | 0.139851 | no |
| Initials | DIF_cap_skin | 0.004928 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.075382 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.300496 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.059121 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.043121 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.080532 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.530129 | no |
| Pileal_Stipeal_center | YFB_veil | 0.602983 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.679115 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.972599 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.732888 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.348961 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.031088 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.266337 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.680906 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.228362 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.173970 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.283077 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.909299 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.957343 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.702416 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.963086 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.743952 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.133428 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | DIF_gill_tissue | 0.064520 | no |
| DIF_stipe_center | YFB_stipe_center | 0.309456 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.052346 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.037364 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.068461 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.555439 | no |
| DIF_stipe_center | YFB_veil | 0.634235 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.767201 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.361031 | no |
| DIF_stipe_center | DIF_cap_skin | 0.025205 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.222361 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.619611 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.186808 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.142789 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.240830 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.862655 | no |
| DIF_stipe_shell | YFB_veil | 0.916942 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.686418 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.106812 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.577094 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.959217 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.521798 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.437868 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.591974 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.869671 | no |
| DIF_stipe_skin | YFB_veil | 0.812413 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.362644 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.008791 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.848533 | no |
| DIF_cap_skin | YFB_stipe_center | 0.426406 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.901508 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.960455 | no |
| DIF_cap_skin | YFB_cap_skin | 0.839658 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.204693 | no |
| DIF_cap_skin | YFB_veil | 0.165414 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.195682 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.094657 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.014081 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.121416 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.168144 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.091499 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.004548 | yes |
| DIF_cap_tissue | YFB_veil | 0.002525 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|105890 MHRLIVILFSSATLAMVKGMPGLTQYARDGCNVNQVTHCCQEMTTTDDAYAIQILHELGFPIDSNAVVVGKKCTE HDGNNCVASPVCCSGNLDHETALNCSPVNHNGVERD* |
| Coding | >AgabiH97|105890 ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA CACGATGGAAACAACTGCGTCGCATCCCCCGTTTGCTGCAGTGGGAACCTGGACCACGAGACTGCACTGAACTGT AGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA |
| Transcript | >AgabiH97|105890 ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA CACGATGGAAACAACTGCGTCGCATCCCCCGTTTGCTGCAGTGGGAACCTGGACCACGAGACTGCACTGAACTGT AGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA |
| Gene | >AgabiH97|105890 ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA CACGATGGAAACAACTGGTTAGTCGCTGGCTACATTTGATAGCTTTAAAACTCTTAACAATGGACTAGCGTCGCA TCCCCCGTTTGCTGCAGTGGGAACCTGGACCGTTGGTGTTGCCTTTACATGCTACAATATAGAAAACTGACTACT TGGATACAGACGAGACTGCACTGAACTGTAGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA |