Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|105890
Gene name
Locationscaffold_7:2244793..2245233
Strand-
Gene length (bp)440
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 5.5E-05 31 103

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 4 106 3.0E-07

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 1722.84 1012.07 2433.60
Initials Initials knots 3399.10 1852.73 4945.47
Pileal_Stipeal_center Stage I stipe center 2989.71 1582.04 4397.38
Pileal_Stipeal_shell Stage I stipe shell 2491.45 1416.03 3566.87
DIF_stipe_center Stage II stipe center 2930.71 1654.13 4207.30
DIF_stipe_shell Stage II stipe shell 2559.08 1456.49 3661.67
DIF_stipe_skin Stage II stipe skin 2158.02 1245.15 3070.89
DIF_cap_skin Stage II cap skin 1599.38 948.22 2250.53
DIF_cap_tissue Stage II cap tissue 1092.79 653.27 1532.32
DIF_gill_tissue Stage II gill tissue 1750.79 1021.67 2479.91
YFB_stipe_center Young fruiting body stipe center 2097.77 1217.08 2978.47
YFB_stipe_shell Young fruiting body stipe shell 1704.87 1008.26 2401.49
YFB_stipe_skin Young fruiting body stipe skin 1644.39 972.19 2316.60
YFB_cap_skin Young fruiting body cap skin 1758.25 1027.36 2489.13
YFB_cap_tissue Young fruiting body cap tissue 259.21 140.59 377.84
YFB_gill_tissue Young fruiting body gill tissue 2344.00 1345.81 3342.18
YFB_veil Young fruiting body veil 2415.80 1379.71 3451.88

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.976915 no
Casing YFB_stipe_center 0.612501 no
Casing YFB_stipe_shell 0.984964 no
Casing YFB_stipe_skin 0.931811 no
Casing YFB_cap_skin 0.970292 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.350240 no
Casing YFB_veil 0.295435 no
Casing Initials 0.013782 yes
Casing Pileal_Stipeal_center 0.064141 no
Casing Pileal_Stipeal_shell 0.238319 no
Casing DIF_stipe_center 0.053565 no
Casing DIF_stipe_shell 0.196757 no
Casing DIF_stipe_skin 0.541827 no
Casing DIF_cap_skin 0.881795 no
Casing DIF_cap_tissue 0.102673 no
DIF_gill_tissue YFB_stipe_center 0.659249 no
DIF_gill_tissue YFB_stipe_shell 0.962556 no
DIF_gill_tissue YFB_stipe_skin 0.905219 no
DIF_gill_tissue YFB_cap_skin 0.993329 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.387205 no
DIF_gill_tissue YFB_veil 0.332527 no
YFB_stipe_center YFB_stipe_shell 0.588747 no
YFB_stipe_center YFB_stipe_skin 0.504690 no
YFB_stipe_center YFB_cap_skin 0.660458 no
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.813651 no
YFB_stipe_center YFB_veil 0.749874 no
YFB_stipe_shell YFB_stipe_skin 0.949084 no
YFB_stipe_shell YFB_cap_skin 0.955624 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.330826 no
YFB_stipe_shell YFB_veil 0.278986 no
YFB_stipe_skin YFB_cap_skin 0.895686 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.266541 no
YFB_stipe_skin YFB_veil 0.219634 no
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.399222 no
YFB_cap_skin YFB_veil 0.344404 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.957565 no
Initials DIF_gill_tissue 0.014956 yes
Initials YFB_stipe_center 0.110863 no
Initials YFB_stipe_shell 0.011659 yes
Initials YFB_stipe_skin 0.008121 yes
Initials YFB_cap_skin 0.017226 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.256555 no
Initials YFB_veil 0.317790 no
Initials Pileal_Stipeal_center 0.800113 no
Initials Pileal_Stipeal_shell 0.381968 no
Initials DIF_stipe_center 0.744023 no
Initials DIF_stipe_shell 0.438005 no
Initials DIF_stipe_skin 0.139851 no
Initials DIF_cap_skin 0.004928 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.075382 no
Pileal_Stipeal_center YFB_stipe_center 0.300496 no
Pileal_Stipeal_center YFB_stipe_shell 0.059121 no
Pileal_Stipeal_center YFB_stipe_skin 0.043121 yes
Pileal_Stipeal_center YFB_cap_skin 0.080532 no
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.530129 no
Pileal_Stipeal_center YFB_veil 0.602983 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.679115 no
Pileal_Stipeal_center DIF_stipe_center 0.972599 no
Pileal_Stipeal_center DIF_stipe_shell 0.732888 no
Pileal_Stipeal_center DIF_stipe_skin 0.348961 no
Pileal_Stipeal_center DIF_cap_skin 0.031088 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.266337 no
Pileal_Stipeal_shell YFB_stipe_center 0.680906 no
Pileal_Stipeal_shell YFB_stipe_shell 0.228362 no
Pileal_Stipeal_shell YFB_stipe_skin 0.173970 no
Pileal_Stipeal_shell YFB_cap_skin 0.283077 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.909299 no
Pileal_Stipeal_shell YFB_veil 0.957343 no
Pileal_Stipeal_shell DIF_stipe_center 0.702416 no
Pileal_Stipeal_shell DIF_stipe_shell 0.963086 no
Pileal_Stipeal_shell DIF_stipe_skin 0.743952 no
Pileal_Stipeal_shell DIF_cap_skin 0.133428 no
Pileal_Stipeal_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_center DIF_gill_tissue 0.064520 no
DIF_stipe_center YFB_stipe_center 0.309456 no
DIF_stipe_center YFB_stipe_shell 0.052346 no
DIF_stipe_center YFB_stipe_skin 0.037364 yes
DIF_stipe_center YFB_cap_skin 0.068461 no
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.555439 no
DIF_stipe_center YFB_veil 0.634235 no
DIF_stipe_center DIF_stipe_shell 0.767201 no
DIF_stipe_center DIF_stipe_skin 0.361031 no
DIF_stipe_center DIF_cap_skin 0.025205 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.222361 no
DIF_stipe_shell YFB_stipe_center 0.619611 no
DIF_stipe_shell YFB_stipe_shell 0.186808 no
DIF_stipe_shell YFB_stipe_skin 0.142789 no
DIF_stipe_shell YFB_cap_skin 0.240830 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.862655 no
DIF_stipe_shell YFB_veil 0.916942 no
DIF_stipe_shell DIF_stipe_skin 0.686418 no
DIF_stipe_shell DIF_cap_skin 0.106812 no
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.577094 no
DIF_stipe_skin YFB_stipe_center 0.959217 no
DIF_stipe_skin YFB_stipe_shell 0.521798 no
DIF_stipe_skin YFB_stipe_skin 0.437868 no
DIF_stipe_skin YFB_cap_skin 0.591974 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.869671 no
DIF_stipe_skin YFB_veil 0.812413 no
DIF_stipe_skin DIF_cap_skin 0.362644 no
DIF_stipe_skin DIF_cap_tissue 0.008791 yes
DIF_cap_skin DIF_gill_tissue 0.848533 no
DIF_cap_skin YFB_stipe_center 0.426406 no
DIF_cap_skin YFB_stipe_shell 0.901508 no
DIF_cap_skin YFB_stipe_skin 0.960455 no
DIF_cap_skin YFB_cap_skin 0.839658 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.204693 no
DIF_cap_skin YFB_veil 0.165414 no
DIF_cap_skin DIF_cap_tissue 0.195682 no
DIF_cap_tissue DIF_gill_tissue 0.094657 no
DIF_cap_tissue YFB_stipe_center 0.014081 yes
DIF_cap_tissue YFB_stipe_shell 0.121416 no
DIF_cap_tissue YFB_stipe_skin 0.168144 no
DIF_cap_tissue YFB_cap_skin 0.091499 no
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.004548 yes
DIF_cap_tissue YFB_veil 0.002525 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|105890
MHRLIVILFSSATLAMVKGMPGLTQYARDGCNVNQVTHCCQEMTTTDDAYAIQILHELGFPIDSNAVVVGKKCTE
HDGNNCVASPVCCSGNLDHETALNCSPVNHNGVERD*
Coding >AgabiH97|105890
ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA
TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT
GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA
CACGATGGAAACAACTGCGTCGCATCCCCCGTTTGCTGCAGTGGGAACCTGGACCACGAGACTGCACTGAACTGT
AGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA
Transcript >AgabiH97|105890
ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA
TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT
GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA
CACGATGGAAACAACTGCGTCGCATCCCCCGTTTGCTGCAGTGGGAACCTGGACCACGAGACTGCACTGAACTGT
AGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA
Gene >AgabiH97|105890
ATGCATCGCCTTATAGTTATCCTGTTTTCCTCGGCGACCTTGGCTATGGTGAAGGGCATGCCTGGACTTACTCAA
TATGCTAGGGATGGCTGCAATGTCAATCAAGTCACCCACTGCTGCCAGGAGATGACCACCACCGATGATGCCTAT
GCCATTCAAATACTTCATGAGCTGGGCTTTCCAATTGATTCCAATGCTGTGGTTGTGGGCAAAAAATGTACTGAA
CACGATGGAAACAACTGGTTAGTCGCTGGCTACATTTGATAGCTTTAAAACTCTTAACAATGGACTAGCGTCGCA
TCCCCCGTTTGCTGCAGTGGGAACCTGGACCGTTGGTGTTGCCTTTACATGCTACAATATAGAAAACTGACTACT
TGGATACAGACGAGACTGCACTGAACTGTAGTCCCGTTAATCACAACGGAGTTGAGCGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail