Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|105830
Gene name
Locationscaffold_7:2221128..2224636
Strand-
Gene length (bp)3508
Transcript length (bp)3279
Coding sequence length (bp)3279
Protein length (aa) 1093

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.7E-33 58 373
PF07993 NAD_binding_4 Male sterility protein 1.1E-20 719 971
PF00550 PP-binding Phosphopantetheine attachment site 2.9E-04 584 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 576 1005 3.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 604 1031 2.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 61 525 5.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 593 1092 1.0E-08
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 700 977 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 576 1005 3.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 604 1031 2.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 61 525 5.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 593 1092 1.0E-08
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 700 977 1.0E-08
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 596 985 1.0E-08
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 712 958 1.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 61 359 3.0E-07
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 62 474 4.0E-07
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 593 972 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|105830
MSSTASGSTFVRPHVNIGYSDDRPDGIETLPDLVEFAAKHNPDHIFGQQLRANDLANPCIITFSQLAYAVERASA
WLVGVGATTGRTEHEDKIPPVALLCGSDITLYIYMCALLRIGAPVLQISARLTPVAILHLLKSTNPSAVIVSSQV
SHAVHETIQMYDKEQPDGFIYPKIVESVGYESFLRPTGALAKYPVPPKCAKFDHSDVEAFIMHSSGTTGLPKPIG
HSQAYPLLYPRCHRIPEQDEPFRYQVSTLPLYHGFGLMAPSLSLGIGIPFVMPPAATIPTGKSALAMLNSTGARY
LLTVPSILEDILNLPDGVGLKALQKLEYVVIGGAALKDSVGDELVSNGVHLLNHWGTTEIGCITPIQRVPPGHDW
HYLIPRSDTGLKFLPSEDGSGGYHLVGRAPGWAEDHVNQDLLEAHPQNKNQFRIMGRADDLIVLATGEKVRPTTL
EQTLCEHPDVKDVLAFGNGQTALGLIVELRSDSSWEINDPKALQSLRVSIDPYLEKGNSFIDAQGKVTRDMIVFA
KQDTERQLLRADKGSLLRKANWIAFEADIKAAYEHTENVTAAPLPLPSVDGGEALLTAIRSQVEQVCPAIISANN
DTADFFEAGMDSLQATRLRRALLNGLKATRGLPAPVTDLESDFIFENSSTVKLFNAVKEAMQGAHNDTEDKETKR
IRIMEDMEAKYRLELASYAGVAAEARQKRKEYIGDYDDRKVILLTGSTGSLGCFLLARLAGDTSVRKVYCLNRAV
SGTRARERQIDLMGKRGAKMDERDWEKVDILEAEPSKEDLGLGEAKYNEIVGVTHIIHNAWPVNFSRNLASFEPH
IKAFANLFRLAIQSSGARPSNADPTRVIFTSSIAVASHFHTHNPDGPAEIPEIPLGAINSGDWGYPEGKWVGERI
GLAANEMYGQDDALVQSSTVRIGQMTGPEGSGAWNESEHVPLIVQSCSKLAAVPALKGSFSWIPVNRACEVLSEL
LFAKNFRPVSHLENPARQSWEGFVEEVASILGGSQPLPIISFGEWLDKVKAAGEEKNPAHKVLNFLETNFVHHLA
AGIVLDTSGARSESPTLVKSTAIGRQHLEEYITYWRRVGDMQ*
Coding >AgabiH97|105830
ATGTCATCCACTGCCTCCGGAAGCACTTTTGTTCGGCCTCATGTCAACATTGGTTACAGTGATGATCGCCCCGAT
GGCATTGAAACCCTCCCCGACCTCGTAGAATTCGCCGCTAAACACAATCCCGACCATATATTCGGCCAGCAACTC
CGGGCCAATGACCTAGCAAACCCTTGCATCATCACTTTTTCTCAGCTAGCATATGCAGTTGAGCGTGCTTCCGCT
TGGCTTGTAGGCGTCGGTGCAACCACCGGACGTACCGAGCATGAGGATAAGATTCCTCCTGTTGCTCTACTCTGT
GGCAGCGACATTACCCTCTACATCTATATGTGCGCTTTATTGAGGATCGGAGCTCCCGTACTCCAAATTTCCGCT
CGCCTGACCCCTGTTGCCATTCTGCATCTTTTAAAGAGCACCAATCCAAGCGCTGTCATCGTTTCTAGCCAAGTG
TCTCATGCCGTGCACGAGACGATCCAAATGTACGACAAAGAACAGCCTGATGGCTTCATATACCCAAAGATCGTA
GAATCTGTTGGCTACGAAAGCTTCTTAAGACCCACTGGTGCCCTTGCCAAATACCCCGTTCCTCCTAAATGTGCC
AAATTCGACCACTCCGATGTCGAAGCGTTCATCATGCATTCTTCCGGTACTACCGGCCTTCCCAAACCTATCGGC
CACAGTCAGGCATATCCTCTTCTATACCCCCGGTGCCACCGTATTCCAGAACAAGACGAGCCATTCCGATATCAA
GTCTCTACTCTGCCATTATACCATGGATTTGGACTAATGGCTCCCTCGCTTTCTTTAGGGATAGGTATCCCATTC
GTCATGCCTCCAGCAGCCACGATACCCACTGGCAAGAGCGCTCTCGCTATGTTGAATTCCACGGGAGCTCGATAC
CTGCTCACCGTTCCCTCAATTCTCGAAGATATACTGAACCTTCCTGATGGAGTTGGCCTTAAAGCACTCCAGAAA
CTTGAGTATGTGGTCATTGGCGGTGCTGCCTTGAAAGACTCCGTTGGCGATGAATTGGTTTCTAATGGTGTCCAT
CTCCTGAACCACTGGGGTACCACTGAGATAGGTTGCATCACACCTATCCAGCGAGTTCCTCCAGGGCACGATTGG
CATTATCTGATACCTCGCAGCGATACTGGACTGAAATTCCTCCCTTCGGAAGACGGCAGCGGAGGTTACCATCTT
GTTGGCCGTGCTCCGGGTTGGGCCGAAGACCACGTTAACCAAGATCTCCTCGAGGCCCACCCTCAGAACAAGAAC
CAATTCAGGATCATGGGCCGTGCTGATGATCTGATTGTCCTTGCTACAGGCGAGAAAGTGCGGCCCACCACCCTA
GAACAGACACTCTGCGAGCACCCAGACGTCAAGGATGTTCTTGCTTTCGGGAACGGTCAGACTGCCCTTGGTCTG
ATTGTCGAGTTGAGATCAGATTCATCATGGGAGATCAATGACCCCAAGGCCCTTCAAAGTCTTCGCGTGTCGATA
GACCCTTATCTTGAAAAGGGCAACTCGTTCATTGATGCGCAGGGGAAGGTCACTCGTGATATGATCGTTTTCGCC
AAACAAGATACCGAACGTCAACTTCTCCGTGCCGATAAAGGCAGCCTCCTGCGTAAAGCCAATTGGATTGCTTTC
GAAGCCGATATCAAAGCAGCTTATGAACATACCGAGAACGTGACTGCTGCACCCCTCCCTCTTCCTTCTGTTGAT
GGCGGCGAGGCACTCTTAACGGCCATCCGCAGCCAAGTTGAACAAGTCTGCCCCGCTATCATTTCCGCTAATAAT
GACACTGCCGACTTTTTCGAGGCTGGTATGGACAGTCTCCAAGCAACTCGACTTCGTCGTGCTCTCCTTAACGGC
CTCAAGGCTACTCGGGGTCTCCCTGCTCCTGTCACTGACCTCGAATCGGACTTCATCTTCGAGAACTCTTCCACT
GTGAAGCTGTTTAATGCCGTGAAGGAGGCTATGCAGGGAGCGCATAACGACACGGAAGATAAGGAAACGAAAAGA
ATTAGGATTATGGAAGATATGGAAGCGAAGTATCGTTTAGAACTGGCTTCTTATGCCGGCGTTGCCGCCGAGGCT
CGTCAGAAGAGGAAGGAATACATAGGAGATTACGATGACCGCAAGGTGATCTTGTTGACTGGTTCCACCGGCAGT
CTAGGATGCTTCCTACTAGCGCGATTGGCAGGAGACACGAGTGTTAGGAAGGTCTATTGTCTGAATCGTGCAGTT
TCGGGTACCAGGGCTCGTGAAAGACAGATAGATCTAATGGGTAAGAGAGGCGCCAAGATGGACGAGAGGGATTGG
GAAAAGGTTGACATTCTCGAAGCCGAGCCTAGCAAAGAAGATTTGGGCCTTGGCGAGGCAAAATACAATGAGATC
GTCGGCGTTACTCATATCATTCACAATGCTTGGCCCGTTAATTTCAGTCGTAATTTGGCCTCATTTGAACCCCAC
ATCAAGGCGTTCGCAAACTTATTCCGTCTAGCAATCCAGAGTTCTGGAGCCCGTCCATCTAATGCCGATCCTACG
CGTGTCATCTTCACGTCCTCGATCGCCGTAGCCAGTCATTTCCATACCCACAATCCAGACGGCCCTGCCGAAATT
CCCGAGATTCCTCTAGGTGCCATTAATTCTGGAGATTGGGGTTACCCTGAAGGCAAATGGGTAGGCGAACGTATT
GGACTAGCCGCGAATGAAATGTACGGCCAAGACGATGCGCTGGTTCAAAGTTCAACTGTCCGCATTGGTCAAATG
ACGGGCCCGGAAGGATCTGGAGCTTGGAACGAAAGCGAACATGTCCCACTCATCGTGCAATCTTGTTCTAAACTC
GCAGCAGTTCCCGCACTCAAGGGATCATTCTCGTGGATCCCCGTCAACAGGGCTTGTGAGGTTCTCTCTGAGCTG
CTGTTTGCGAAGAATTTCAGGCCGGTTTCTCATCTGGAGAATCCAGCTCGTCAGTCATGGGAGGGTTTCGTTGAA
GAAGTCGCTTCAATCCTGGGTGGCTCACAGCCTCTACCTATTATTTCGTTCGGCGAGTGGTTGGACAAGGTCAAA
GCTGCAGGTGAAGAGAAGAATCCGGCTCATAAAGTGCTGAATTTCTTGGAAACCAATTTCGTGCACCACTTGGCT
GCTGGAATTGTTTTGGATACTTCGGGAGCGAGGAGCGAATCACCGACTTTGGTGAAGAGTACAGCGATTGGCCGG
CAGCACCTGGAGGAGTATATCACTTATTGGAGAAGAGTAGGAGATATGCAGTGA
Transcript >AgabiH97|105830
ATGTCATCCACTGCCTCCGGAAGCACTTTTGTTCGGCCTCATGTCAACATTGGTTACAGTGATGATCGCCCCGAT
GGCATTGAAACCCTCCCCGACCTCGTAGAATTCGCCGCTAAACACAATCCCGACCATATATTCGGCCAGCAACTC
CGGGCCAATGACCTAGCAAACCCTTGCATCATCACTTTTTCTCAGCTAGCATATGCAGTTGAGCGTGCTTCCGCT
TGGCTTGTAGGCGTCGGTGCAACCACCGGACGTACCGAGCATGAGGATAAGATTCCTCCTGTTGCTCTACTCTGT
GGCAGCGACATTACCCTCTACATCTATATGTGCGCTTTATTGAGGATCGGAGCTCCCGTACTCCAAATTTCCGCT
CGCCTGACCCCTGTTGCCATTCTGCATCTTTTAAAGAGCACCAATCCAAGCGCTGTCATCGTTTCTAGCCAAGTG
TCTCATGCCGTGCACGAGACGATCCAAATGTACGACAAAGAACAGCCTGATGGCTTCATATACCCAAAGATCGTA
GAATCTGTTGGCTACGAAAGCTTCTTAAGACCCACTGGTGCCCTTGCCAAATACCCCGTTCCTCCTAAATGTGCC
AAATTCGACCACTCCGATGTCGAAGCGTTCATCATGCATTCTTCCGGTACTACCGGCCTTCCCAAACCTATCGGC
CACAGTCAGGCATATCCTCTTCTATACCCCCGGTGCCACCGTATTCCAGAACAAGACGAGCCATTCCGATATCAA
GTCTCTACTCTGCCATTATACCATGGATTTGGACTAATGGCTCCCTCGCTTTCTTTAGGGATAGGTATCCCATTC
GTCATGCCTCCAGCAGCCACGATACCCACTGGCAAGAGCGCTCTCGCTATGTTGAATTCCACGGGAGCTCGATAC
CTGCTCACCGTTCCCTCAATTCTCGAAGATATACTGAACCTTCCTGATGGAGTTGGCCTTAAAGCACTCCAGAAA
CTTGAGTATGTGGTCATTGGCGGTGCTGCCTTGAAAGACTCCGTTGGCGATGAATTGGTTTCTAATGGTGTCCAT
CTCCTGAACCACTGGGGTACCACTGAGATAGGTTGCATCACACCTATCCAGCGAGTTCCTCCAGGGCACGATTGG
CATTATCTGATACCTCGCAGCGATACTGGACTGAAATTCCTCCCTTCGGAAGACGGCAGCGGAGGTTACCATCTT
GTTGGCCGTGCTCCGGGTTGGGCCGAAGACCACGTTAACCAAGATCTCCTCGAGGCCCACCCTCAGAACAAGAAC
CAATTCAGGATCATGGGCCGTGCTGATGATCTGATTGTCCTTGCTACAGGCGAGAAAGTGCGGCCCACCACCCTA
GAACAGACACTCTGCGAGCACCCAGACGTCAAGGATGTTCTTGCTTTCGGGAACGGTCAGACTGCCCTTGGTCTG
ATTGTCGAGTTGAGATCAGATTCATCATGGGAGATCAATGACCCCAAGGCCCTTCAAAGTCTTCGCGTGTCGATA
GACCCTTATCTTGAAAAGGGCAACTCGTTCATTGATGCGCAGGGGAAGGTCACTCGTGATATGATCGTTTTCGCC
AAACAAGATACCGAACGTCAACTTCTCCGTGCCGATAAAGGCAGCCTCCTGCGTAAAGCCAATTGGATTGCTTTC
GAAGCCGATATCAAAGCAGCTTATGAACATACCGAGAACGTGACTGCTGCACCCCTCCCTCTTCCTTCTGTTGAT
GGCGGCGAGGCACTCTTAACGGCCATCCGCAGCCAAGTTGAACAAGTCTGCCCCGCTATCATTTCCGCTAATAAT
GACACTGCCGACTTTTTCGAGGCTGGTATGGACAGTCTCCAAGCAACTCGACTTCGTCGTGCTCTCCTTAACGGC
CTCAAGGCTACTCGGGGTCTCCCTGCTCCTGTCACTGACCTCGAATCGGACTTCATCTTCGAGAACTCTTCCACT
GTGAAGCTGTTTAATGCCGTGAAGGAGGCTATGCAGGGAGCGCATAACGACACGGAAGATAAGGAAACGAAAAGA
ATTAGGATTATGGAAGATATGGAAGCGAAGTATCGTTTAGAACTGGCTTCTTATGCCGGCGTTGCCGCCGAGGCT
CGTCAGAAGAGGAAGGAATACATAGGAGATTACGATGACCGCAAGGTGATCTTGTTGACTGGTTCCACCGGCAGT
CTAGGATGCTTCCTACTAGCGCGATTGGCAGGAGACACGAGTGTTAGGAAGGTCTATTGTCTGAATCGTGCAGTT
TCGGGTACCAGGGCTCGTGAAAGACAGATAGATCTAATGGGTAAGAGAGGCGCCAAGATGGACGAGAGGGATTGG
GAAAAGGTTGACATTCTCGAAGCCGAGCCTAGCAAAGAAGATTTGGGCCTTGGCGAGGCAAAATACAATGAGATC
GTCGGCGTTACTCATATCATTCACAATGCTTGGCCCGTTAATTTCAGTCGTAATTTGGCCTCATTTGAACCCCAC
ATCAAGGCGTTCGCAAACTTATTCCGTCTAGCAATCCAGAGTTCTGGAGCCCGTCCATCTAATGCCGATCCTACG
CGTGTCATCTTCACGTCCTCGATCGCCGTAGCCAGTCATTTCCATACCCACAATCCAGACGGCCCTGCCGAAATT
CCCGAGATTCCTCTAGGTGCCATTAATTCTGGAGATTGGGGTTACCCTGAAGGCAAATGGGTAGGCGAACGTATT
GGACTAGCCGCGAATGAAATGTACGGCCAAGACGATGCGCTGGTTCAAAGTTCAACTGTCCGCATTGGTCAAATG
ACGGGCCCGGAAGGATCTGGAGCTTGGAACGAAAGCGAACATGTCCCACTCATCGTGCAATCTTGTTCTAAACTC
GCAGCAGTTCCCGCACTCAAGGGATCATTCTCGTGGATCCCCGTCAACAGGGCTTGTGAGGTTCTCTCTGAGCTG
CTGTTTGCGAAGAATTTCAGGCCGGTTTCTCATCTGGAGAATCCAGCTCGTCAGTCATGGGAGGGTTTCGTTGAA
GAAGTCGCTTCAATCCTGGGTGGCTCACAGCCTCTACCTATTATTTCGTTCGGCGAGTGGTTGGACAAGGTCAAA
GCTGCAGGTGAAGAGAAGAATCCGGCTCATAAAGTGCTGAATTTCTTGGAAACCAATTTCGTGCACCACTTGGCT
GCTGGAATTGTTTTGGATACTTCGGGAGCGAGGAGCGAATCACCGACTTTGGTGAAGAGTACAGCGATTGGCCGG
CAGCACCTGGAGGAGTATATCACTTATTGGAGAAGAGTAGGAGATATGCAGTGA
Gene >AgabiH97|105830
ATGTCATCCACTGCCTCCGGAAGCACTTTTGTTCGGCCTCATGTCAACATTGGTTACAGTGATGATCGCCCCGAT
GGCATTGAAACCCTCCCCGACCTCGTAGAATTCGCCGCTAAACACAATCCCGACCATATATTCGGCCAGCAACTC
CGGGCCAATGACCTAGCAAACCCTTGCATCATCACTTTTTCTCAGCTAGCATATGCAGTTGAGCGTGCTTCCGCT
TGGCTTGTAGGCGTCGGTGCAACCACCGGACGTACCGAGCATGAGGATAAGATTCCTCCTGTTGCTCTACTCTGT
GGCAGCGACATTACCCTCTACATCTATATGTGCGCTTTATTGAGGATCGGAGCTCCCGTGAGTTGCTGTTTCCAC
CTAATCATGTTCCTTTTTCTTCTTCATCCTCGAATGCTTATCAATCTACTCAGGTACTCCAAATTTCCGCTCGCC
TGACCCCTGTTGCCATTCTGCATCTTTTAAAGAGCACCAATCCAAGCGCTGTCATCGTTTCTAGCCAAGTGTCTC
ATGCCGTGCACGAGACGATCCAAATGTACGACAAAGAACAGCCTGATGGCTTCATATACCCAAAGATCGTAGAAT
CTGTTGGCTACGAAAGCTTCTTAAGACCCACTGGTGCCCTTGCCAAATACCCCGTTCCTCCTAAATGTGCCAAAT
TCGACCACTCCGATGTCGAAGCGTTCATCATGCATTCTTCCGGTACTACCGGCCTTCCCAAACCTATCGGCCACA
GTCAGGCATATCCTCTTCTATACCCCCGGTGCCACCGTATTCCAGAACAAGACGAGCCATTCCGATATCAAGTCT
CTACTCTGCCATTATACCATGTGAGTATATCTAGCCTCTGCGGGTGGTTTACAATCTAATTAGCGTTTACAGGGA
TTTGGACTAATGGCTCCCTCGCTTTCTTTAGGGATAGGTATCCCATTCGTCATGCCTCCAGCAGCCACGATACCC
ACTGGCAAGAGCGCTCTCGCTATGTTGAATTCCACGGGAGCTCGATACCTGCTCACCGTTCCCTCAATTCTCGAA
GATATACTGAACCTTCCTGATGGAGTTGGCCTTAAAGCACTCCAGAAACTTGAGTATGTGGTCATTGGCGGTGCT
GCCTTGAAAGACTCCGTTGGCGATGAATTGGTTTCTAATGGTGTCCATCTCCTGAACCACTGGGGTGGGTTGGCC
TTGTATGAACCGTAGATGACGACGCAACTAATGCTGCTCTATAGGTACCACTGAGATAGGTTGCATCACACCTAT
CCAGCGAGTTCCTCCAGGGCACGATTGGCATTATCTGATACCTCGCAGCGATACTGGACTGAAATTCCTCCCTTC
GGAAGACGGCAGCGGAGGTTACCATCTTGTTGGCCGTGCTCCGGGTTGGGCCGAAGACCACGTTAACCAAGATCT
CCTCGAGGCCCACCCTCAGAACAAGAACCAATTCAGGATCATGGGCCGTGCTGATGATCTGATTGTCCTTGCTAC
AGGCGAGAAAGTGCGGCCCACCACCCTAGAACAGACACTCTGCGAGCACCCAGACGTCAAGGATGTTCTTGCTTT
CGGGAACGGTCAGACTGCCCTTGGTCTGATTGTCGAGTTGAGATCAGATTCATCATGGGAGATCAATGACCCCAA
GGCCCTTCAAAGTCTTCGCGTGTCGATAGACCCTTATCTTGAAAAGGGCAACTCGTTCATTGATGCGCAGGGGAA
GGTCACTCGTGATATGATCGTTTTCGCCAAACAAGATACCGAACGTCAACTTCTCCGTGCCGATAAAGGCAGCCT
CCTGCGTAAAGCCAATTGGATTGCTTTCGAAGCCGATATCAAAGCAGCTTATGAACATACCGAGAACGTGACTGC
TGCACCCCTCCCTCTTCCTTCTGTTGATGGCGGCGAGGCACTCTTAACGGCCATCCGCAGCCAAGTTGAACAAGT
CTGCCCCGCTATCATTTCCGCTAATAATGACACTGCCGACTTTTTCGAGGCTGGTATGGACAGTCTCCAAGCAAC
TCGACTTCGTCGTGCTCTCCTTAACGGCCTCAAGGCTACTCGGGGTCTCCCTGCTCCTGTCACTGACCTCGAATC
GGACTTCATCTTCGAGAACTCTTCCACTGTGAAGCTGTTTAATGCCGTGAAGGAGGCTATGCAGGGAGCGCATAA
CGACACGGAAGATAAGGAAACGAAAAGAATTAGGATTATGGAAGATATGGAAGCGAAGTATCGTTTAGAACTGGC
TTCTTATGCCGGCGTTGCCGCCGAGGCTCGTCAGAAGAGGAAGGAATACATAGGAGATTACGATGACCGCAAGGT
GATCTTGTTGACTGGTTCCACCGGCAGTCTAGGATGCTTCCTACTAGCGCGATTGGCAGGAGACACGAGTGTTAG
GAAGGTCTATTGTCTGAATCGTGCAGTTTCGGGTACCAGGGCTCGTGAAAGACAGATAGATCTAATGGGTAAGAG
AGGCGCCAAGATGGACGAGAGGGATTGGGAAAAGGTTGACATTCTCGAAGCCGAGCCTAGCAAAGAAGATTTGGG
CCTTGGCGAGGCAAAATACAATGAGGTTCGTAGTATGCTTGGACTTCCGGGACTTAATCGCTCACATTGCTATTA
GATCGTCGGCGTTACTCATATCATTCACAATGCTTGGCCCGTTAATTTCAGTCGTAATTTGGCCTCATTTGAACC
CCACATCAAGGCGTTCGCAAACTTATTCCGTCTAGCAATCCAGAGTTCTGGAGCCCGTCCATCTAATGCCGATCC
TACGCGTGTCATCTTCACGTCCTCGATCGCCGTAGCCAGTCATTTCCATACCCACAATCCAGACGGCCCTGCCGA
AATTCCCGAGATTCCTCTAGGTGCCATTAATTCTGGAGATTGGGGTTACCCTGAAGGCAAATGGGTAGGCGAACG
TATTGGACTAGCCGCGAATGAAATGTACGGCCAAGACGATGCGCTGGTTCAAAGTTCAACTGTCCGCATTGGTCA
AATGACGGGCCCGGAAGGATCTGGAGCTTGGAACGAAAGCGAACATGTCCCACTCATCGTGCAATCTTGTTCTAA
ACTCGCAGCAGTTCCCGCACTCAAGGGATCATTCTCGTGGATCCCCGTCAACAGGGCTTGTGAGGTTCTCTCTGA
GCTGCTGTTTGCGAAGAATTTCAGGCCGGTTTCTCATCTGGAGAATCCAGCTCGTCAGTCATGGGAGGGTTTCGT
TGAAGAAGTCGCTTCAATCCTGGGTGGCTCACAGCCTCTACCTATTATTTCGTTCGGCGAGTGGTTGGACAAGGT
CAAAGCTGCAGGTGAAGAGAAGAATCCGGCTCATAAAGTGCTGAATTTCTTGGAAACCAATTTCGTGCACCACTT
GGCTGCTGGAATTGTTTTGGATACTTCGGGAGCGAGGAGCGAATCACCGACTTTGGTGAAGAGTACAGCGATTGG
CCGGCAGCACCTGGAGGAGTATATCACTTATTGGAGAAGAGTAGGAGATATGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail