Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|105760
Gene name
Locationscaffold_7:2207375..2207721
Strand+
Gene length (bp)346
Transcript length (bp)204
Coding sequence length (bp)204
Protein length (aa) 68

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 220.39 89.00 351.77
Initials Initials knots 111.64 38.34 184.96
Pileal_Stipeal_center Stage I stipe center 145.41 54.88 235.94
Pileal_Stipeal_shell Stage I stipe shell 72.72 19.60 125.84
DIF_stipe_center Stage II stipe center 124.57 44.72 204.43
DIF_stipe_shell Stage II stipe shell 145.37 52.32 238.42
DIF_stipe_skin Stage II stipe skin 104.25 30.35 178.15
DIF_cap_skin Stage II cap skin 77.26 22.41 132.12
DIF_cap_tissue Stage II cap tissue 90.90 29.05 152.74
DIF_gill_tissue Stage II gill tissue 67.55 18.99 116.12
YFB_stipe_center Young fruiting body stipe center 219.24 83.21 355.27
YFB_stipe_shell Young fruiting body stipe shell 196.05 78.89 313.21
YFB_stipe_skin Young fruiting body stipe skin 196.01 78.94 313.08
YFB_cap_skin Young fruiting body cap skin 106.36 34.91 177.80
YFB_cap_tissue Young fruiting body cap tissue 139.94 51.23 228.66
YFB_gill_tissue Young fruiting body gill tissue 71.42 20.33 122.52
YFB_veil Young fruiting body veil 93.91 30.14 157.68

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.004928 yes
Casing YFB_stipe_center 0.993741 no
Casing YFB_stipe_shell 0.875444 no
Casing YFB_stipe_skin 0.875019 no
Casing YFB_cap_skin 0.102830 no
Casing YFB_cap_tissue 0.368074 no
Casing YFB_gill_tissue 0.010093 yes
Casing YFB_veil 0.050908 no
Casing Initials 0.117025 no
Casing Pileal_Stipeal_center 0.411427 no
Casing Pileal_Stipeal_shell 0.017507 yes
Casing DIF_stipe_center 0.219988 no
Casing DIF_stipe_shell 0.428168 no
Casing DIF_stipe_skin 0.101542 no
Casing DIF_cap_skin 0.016949 yes
Casing DIF_cap_tissue 0.041164 yes
DIF_gill_tissue YFB_stipe_center 0.004548 yes
DIF_gill_tissue YFB_stipe_shell 0.011350 yes
DIF_gill_tissue YFB_stipe_skin 0.011968 yes
DIF_gill_tissue YFB_cap_skin 0.438144 no
DIF_gill_tissue YFB_cap_tissue 0.130393 no
DIF_gill_tissue YFB_gill_tissue 0.953385 no
DIF_gill_tissue YFB_veil 0.613387 no
YFB_stipe_center YFB_stipe_shell 0.883616 no
YFB_stipe_center YFB_stipe_skin 0.883329 no
YFB_stipe_center YFB_cap_skin 0.115194 no
YFB_stipe_center YFB_cap_tissue 0.384730 no
YFB_stipe_center YFB_gill_tissue 0.010093 yes
YFB_stipe_center YFB_veil 0.057747 no
YFB_stipe_shell YFB_stipe_skin 0.997042 no
YFB_stipe_shell YFB_cap_skin 0.197709 no
YFB_stipe_shell YFB_cap_tissue 0.549091 no
YFB_stipe_shell YFB_gill_tissue 0.019715 yes
YFB_stipe_shell YFB_veil 0.107767 no
YFB_stipe_skin YFB_cap_skin 0.200211 no
YFB_stipe_skin YFB_cap_tissue 0.552744 no
YFB_stipe_skin YFB_gill_tissue 0.019442 yes
YFB_stipe_skin YFB_veil 0.107767 no
YFB_cap_skin YFB_cap_tissue 0.677104 no
YFB_cap_skin YFB_gill_tissue 0.510519 no
YFB_cap_skin YFB_veil 0.883138 no
YFB_cap_tissue YFB_gill_tissue 0.163299 no
YFB_cap_tissue YFB_veil 0.492977 no
YFB_gill_tissue YFB_veil 0.696716 no
Initials DIF_gill_tissue 0.344495 no
Initials YFB_stipe_center 0.128665 no
Initials YFB_stipe_shell 0.229919 no
Initials YFB_stipe_skin 0.227928 no
Initials YFB_cap_skin 0.955977 no
Initials YFB_cap_tissue 0.736021 no
Initials YFB_gill_tissue 0.418229 no
Initials YFB_veil 0.818139 no
Initials Pileal_Stipeal_center 0.667890 no
Initials Pileal_Stipeal_shell 0.467067 no
Initials DIF_stipe_center 0.891292 no
Initials DIF_stipe_shell 0.680490 no
Initials DIF_stipe_skin 0.937328 no
Initials DIF_cap_skin 0.534722 no
Initials DIF_cap_tissue 0.775432 no
Pileal_Stipeal_center DIF_gill_tissue 0.089301 no
Pileal_Stipeal_center YFB_stipe_center 0.419482 no
Pileal_Stipeal_center YFB_stipe_shell 0.595013 no
Pileal_Stipeal_center YFB_stipe_skin 0.597360 no
Pileal_Stipeal_center YFB_cap_skin 0.603047 no
Pileal_Stipeal_center YFB_cap_tissue 0.965007 no
Pileal_Stipeal_center YFB_gill_tissue 0.122622 no
Pileal_Stipeal_center YFB_veil 0.416662 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.161568 no
Pileal_Stipeal_center DIF_stipe_center 0.830197 no
Pileal_Stipeal_center DIF_stipe_shell 0.996026 no
Pileal_Stipeal_center DIF_stipe_skin 0.580907 no
Pileal_Stipeal_center DIF_cap_skin 0.185817 no
Pileal_Stipeal_center DIF_cap_tissue 0.370665 no
Pileal_Stipeal_shell DIF_gill_tissue 0.936784 no
Pileal_Stipeal_shell YFB_stipe_center 0.015242 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.029648 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.031557 yes
Pileal_Stipeal_shell YFB_cap_skin 0.553322 no
Pileal_Stipeal_shell YFB_cap_tissue 0.202562 no
Pileal_Stipeal_shell YFB_gill_tissue 0.984005 no
Pileal_Stipeal_shell YFB_veil 0.733460 no
Pileal_Stipeal_shell DIF_stipe_center 0.328610 no
Pileal_Stipeal_shell DIF_stipe_shell 0.174105 no
Pileal_Stipeal_shell DIF_stipe_skin 0.594591 no
Pileal_Stipeal_shell DIF_cap_skin 0.949626 no
Pileal_Stipeal_shell DIF_cap_tissue 0.776053 no
DIF_stipe_center DIF_gill_tissue 0.217207 no
DIF_stipe_center YFB_stipe_center 0.232094 no
DIF_stipe_center YFB_stipe_shell 0.373427 no
DIF_stipe_center YFB_stipe_skin 0.371980 no
DIF_stipe_center YFB_cap_skin 0.839463 no
DIF_stipe_center YFB_cap_tissue 0.885942 no
DIF_stipe_center YFB_gill_tissue 0.279861 no
DIF_stipe_center YFB_veil 0.667222 no
DIF_stipe_center DIF_stipe_shell 0.840292 no
DIF_stipe_center DIF_stipe_skin 0.818324 no
DIF_stipe_center DIF_cap_skin 0.379821 no
DIF_stipe_center DIF_cap_tissue 0.615203 no
DIF_stipe_shell DIF_gill_tissue 0.101542 no
DIF_stipe_shell YFB_stipe_center 0.445777 no
DIF_stipe_shell YFB_stipe_shell 0.609960 no
DIF_stipe_shell YFB_stipe_skin 0.612095 no
DIF_stipe_shell YFB_cap_skin 0.620098 no
DIF_stipe_shell YFB_cap_tissue 0.965639 no
DIF_stipe_shell YFB_gill_tissue 0.136175 no
DIF_stipe_shell YFB_veil 0.438425 no
DIF_stipe_shell DIF_stipe_skin 0.600400 no
DIF_stipe_shell DIF_cap_skin 0.199624 no
DIF_stipe_shell DIF_cap_tissue 0.390800 no
DIF_stipe_skin DIF_gill_tissue 0.473138 no
DIF_stipe_skin YFB_stipe_center 0.113185 no
DIF_stipe_skin YFB_stipe_shell 0.197709 no
DIF_stipe_skin YFB_stipe_skin 0.197467 no
DIF_stipe_skin YFB_cap_skin 0.983659 no
DIF_stipe_skin YFB_cap_tissue 0.655094 no
DIF_stipe_skin YFB_gill_tissue 0.550865 no
DIF_stipe_skin YFB_veil 0.906722 no
DIF_stipe_skin DIF_cap_skin 0.663665 no
DIF_stipe_skin DIF_cap_tissue 0.873999 no
DIF_cap_skin DIF_gill_tissue 0.871247 no
DIF_cap_skin YFB_stipe_center 0.015819 yes
DIF_cap_skin YFB_stipe_shell 0.031557 yes
DIF_cap_skin YFB_stipe_skin 0.033906 yes
DIF_cap_skin YFB_cap_skin 0.622277 no
DIF_cap_skin YFB_cap_tissue 0.234297 no
DIF_cap_skin YFB_gill_tissue 0.930907 no
DIF_cap_skin YFB_veil 0.798004 no
DIF_cap_skin DIF_cap_tissue 0.840224 no
DIF_cap_tissue DIF_gill_tissue 0.654502 no
DIF_cap_tissue YFB_stipe_center 0.048834 yes
DIF_cap_tissue YFB_stipe_shell 0.091161 no
DIF_cap_tissue YFB_stipe_skin 0.090829 no
DIF_cap_tissue YFB_cap_skin 0.843379 no
DIF_cap_tissue YFB_cap_tissue 0.442260 no
DIF_cap_tissue YFB_gill_tissue 0.736166 no
DIF_cap_tissue YFB_veil 0.970950 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|105760
MILGSLAFSTLATSATKVVLFIQSSASAPLKSNPLFTVHSWIFLRPALVPLASSNTPPNLPPYSLFR*
Coding >AgabiH97|105760
ATGATTTTAGGGTCACTTGCTTTTTCCACCCTTGCCACGTCCGCAACCAAAGTCGTCCTTTTTATCCAGTCCTCT
GCTTCTGCACCACTTAAGTCTAATCCTCTCTTCACGGTTCATTCTTGGATATTTCTTCGACCGGCTCTAGTTCCG
CTAGCCTCATCCAACACTCCGCCCAATCTCCCTCCCTATTCGCTCTTCCGATAA
Transcript >AgabiH97|105760
ATGATTTTAGGGTCACTTGCTTTTTCCACCCTTGCCACGTCCGCAACCAAAGTCGTCCTTTTTATCCAGTCCTCT
GCTTCTGCACCACTTAAGTCTAATCCTCTCTTCACGGTTCATTCTTGGATATTTCTTCGACCGGCTCTAGTTCCG
CTAGCCTCATCCAACACTCCGCCCAATCTCCCTCCCTATTCGCTCTTCCGATAA
Gene >AgabiH97|105760
ATGATGTGACATGAGGAGGGGAGTCGATTAAGGACTGTTTATCCAGGGATAATCTGCTTTGTTTCTGTCCAACAA
CCTCAGTTTAGGGTCACTTGCTTTTTCCACCCTTGCCACGTCCGCAACCAAAGTCGTCCTTTTTATCCAGTCCTC
TGCTTCTGCACCACTTAAGTCTAATCCTCTCTGTGAGTTATTATGGTCTTGGCTTGTTGGAATCCGGTTGTTGTT
TCGTGCGCTGATACGCAGTTCAGTCACGGTTCATTCTTGGATATTTCTTCGACCGGCTCTAGTTCCGCTAGCCTC
ATCCAACACTCCGCCCAATCTCCCTCCCTATTCGCTCTTCCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail