Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|105620
Gene name
Locationscaffold_7:2161876..2162644
Strand-
Gene length (bp)768
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 6.69 2.44 10.94
Initials Initials knots 10.69 4.26 17.12
Pileal_Stipeal_center Stage I stipe center 7.06 2.56 11.56
Pileal_Stipeal_shell Stage I stipe shell 5.30 1.81 8.79
DIF_stipe_center Stage II stipe center 19.44 8.91 29.98
DIF_stipe_shell Stage II stipe shell 10.52 4.34 16.70
DIF_stipe_skin Stage II stipe skin 8.24 3.21 13.27
DIF_cap_skin Stage II cap skin 6.26 2.25 10.26
DIF_cap_tissue Stage II cap tissue 6.62 2.08 11.17
DIF_gill_tissue Stage II gill tissue 12.52 5.04 20.00
YFB_stipe_center Young fruiting body stipe center 64.40 34.66 94.15
YFB_stipe_shell Young fruiting body stipe shell 66.18 35.55 96.81
YFB_stipe_skin Young fruiting body stipe skin 16.17 7.18 25.16
YFB_cap_skin Young fruiting body cap skin 7.02 2.53 11.50
YFB_cap_tissue Young fruiting body cap tissue 12.21 5.11 19.30
YFB_gill_tissue Young fruiting body gill tissue 9.77 3.86 15.67
YFB_veil Young fruiting body veil 9.55 3.73 15.37

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.157303 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.025711 yes
Casing YFB_cap_skin 0.956671 no
Casing YFB_cap_tissue 0.173970 no
Casing YFB_gill_tissue 0.485998 no
Casing YFB_veil 0.514080 no
Casing Initials 0.342014 no
Casing Pileal_Stipeal_center 0.951865 no
Casing Pileal_Stipeal_shell 0.731782 no
Casing DIF_stipe_center 0.008121 yes
Casing DIF_stipe_shell 0.350999 no
Casing DIF_stipe_skin 0.755783 no
Casing DIF_cap_skin 0.939352 no
Casing DIF_cap_tissue 0.989009 no
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.643093 no
DIF_gill_tissue YFB_cap_skin 0.200802 no
DIF_gill_tissue YFB_cap_tissue 0.973088 no
DIF_gill_tissue YFB_gill_tissue 0.676195 no
DIF_gill_tissue YFB_veil 0.632718 no
YFB_stipe_center YFB_stipe_shell 0.964040 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.041824 yes
YFB_stipe_skin YFB_cap_tissue 0.583676 no
YFB_stipe_skin YFB_gill_tissue 0.244275 no
YFB_stipe_skin YFB_veil 0.217538 no
YFB_cap_skin YFB_cap_tissue 0.226152 no
YFB_cap_skin YFB_gill_tissue 0.561199 no
YFB_cap_skin YFB_veil 0.592716 no
YFB_cap_tissue YFB_gill_tissue 0.710849 no
YFB_cap_tissue YFB_veil 0.670534 no
YFB_gill_tissue YFB_veil 0.978438 no
Initials DIF_gill_tissue 0.815262 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.370023 no
Initials YFB_cap_skin 0.407377 no
Initials YFB_cap_tissue 0.847331 no
Initials YFB_gill_tissue 0.907456 no
Initials YFB_veil 0.878139 no
Initials Pileal_Stipeal_center 0.412746 no
Initials Pileal_Stipeal_shell 0.102020 no
Initials DIF_stipe_center 0.138143 no
Initials DIF_stipe_shell 0.984130 no
Initials DIF_stipe_skin 0.652236 no
Initials DIF_cap_skin 0.250478 no
Initials DIF_cap_tissue 0.358057 no
Pileal_Stipeal_center DIF_gill_tissue 0.204814 no
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.033674 yes
Pileal_Stipeal_center YFB_cap_skin 0.995987 no
Pileal_Stipeal_center YFB_cap_tissue 0.224134 no
Pileal_Stipeal_center YFB_gill_tissue 0.565243 no
Pileal_Stipeal_center YFB_veil 0.598545 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.643574 no
Pileal_Stipeal_center DIF_stipe_center 0.009123 yes
Pileal_Stipeal_center DIF_stipe_shell 0.428168 no
Pileal_Stipeal_center DIF_stipe_skin 0.829297 no
Pileal_Stipeal_center DIF_cap_skin 0.878029 no
Pileal_Stipeal_center DIF_cap_tissue 0.942986 no
Pileal_Stipeal_shell DIF_gill_tissue 0.036455 yes
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.003365 yes
Pileal_Stipeal_shell YFB_cap_skin 0.656991 no
Pileal_Stipeal_shell YFB_cap_tissue 0.039836 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.176313 no
Pileal_Stipeal_shell YFB_veil 0.197235 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.108390 no
Pileal_Stipeal_shell DIF_stipe_skin 0.381638 no
Pileal_Stipeal_shell DIF_cap_skin 0.823646 no
Pileal_Stipeal_shell DIF_cap_tissue 0.753475 no
DIF_stipe_center DIF_gill_tissue 0.331527 no
DIF_stipe_center YFB_stipe_center 0.001625 yes
DIF_stipe_center YFB_stipe_shell 0.001625 yes
DIF_stipe_center YFB_stipe_skin 0.754255 no
DIF_stipe_center YFB_cap_skin 0.010728 yes
DIF_stipe_center YFB_cap_tissue 0.282209 no
DIF_stipe_center YFB_gill_tissue 0.084017 no
DIF_stipe_center YFB_veil 0.070499 no
DIF_stipe_center DIF_stipe_shell 0.120676 no
DIF_stipe_center DIF_stipe_skin 0.024946 yes
DIF_stipe_center DIF_cap_skin 0.003765 yes
DIF_stipe_center DIF_cap_tissue 0.013186 yes
DIF_stipe_shell DIF_gill_tissue 0.788165 no
DIF_stipe_shell YFB_stipe_center 0.000613 yes
DIF_stipe_shell YFB_stipe_shell 0.000613 yes
DIF_stipe_shell YFB_stipe_skin 0.339493 no
DIF_stipe_shell YFB_cap_skin 0.430398 no
DIF_stipe_shell YFB_cap_tissue 0.819478 no
DIF_stipe_shell YFB_gill_tissue 0.923966 no
DIF_stipe_shell YFB_veil 0.895878 no
DIF_stipe_shell DIF_stipe_skin 0.676691 no
DIF_stipe_shell DIF_cap_skin 0.264512 no
DIF_stipe_shell DIF_cap_tissue 0.373006 no
DIF_stipe_skin DIF_gill_tissue 0.390956 no
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.089130 no
DIF_stipe_skin YFB_cap_skin 0.823199 no
DIF_stipe_skin YFB_cap_tissue 0.419780 no
DIF_stipe_skin YFB_gill_tissue 0.798950 no
DIF_stipe_skin YFB_veil 0.831515 no
DIF_stipe_skin DIF_cap_skin 0.650717 no
DIF_stipe_skin DIF_cap_tissue 0.752354 no
DIF_cap_skin DIF_gill_tissue 0.106349 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.016949 yes
DIF_cap_skin YFB_cap_skin 0.885161 no
DIF_cap_skin YFB_cap_tissue 0.118699 no
DIF_cap_skin YFB_gill_tissue 0.385213 no
DIF_cap_skin YFB_veil 0.412746 no
DIF_cap_skin DIF_cap_tissue 0.949958 no
DIF_cap_tissue DIF_gill_tissue 0.172181 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.038278 yes
DIF_cap_tissue YFB_cap_skin 0.949547 no
DIF_cap_tissue YFB_cap_tissue 0.188530 no
DIF_cap_tissue YFB_gill_tissue 0.492252 no
DIF_cap_tissue YFB_veil 0.518458 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|105620
MMFHTLHRISSITTILLSITIAKSLATRHYEILNNCPQAIQIYINGESQGYIDAQTAISHNYQDDFSGFIYSDAN
GGVVDDASANGTTSIGTTRAAFKGTDNYYYILSDKLNTGISIVPVSVNLAGNKENGFCVPIFCDMNSCPHSTDKP
ITHFPQHHDHDHPPQSPLFECPDKNTGYVVTFCPSGVFP*
Coding >AgabiH97|105620
ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA
GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT
TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT
GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG
GATAATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCG
GGTAATAAAGAAAATGGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCT
ATAACTCACTTCCCTCAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAAC
ACTGGTTATGTCGTAACGTTCTGCCCTTCAGGAGTGTTTCCCTAA
Transcript >AgabiH97|105620
ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA
GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT
TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT
GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG
GATAATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCG
GGTAATAAAGAAAATGGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCT
ATAACTCACTTCCCTCAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAAC
ACTGGTTATGTCGTAACGTTCTGCCCTTCAGGAGTGTTTCCCTAA
Gene >AgabiH97|105620
ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA
GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT
TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT
GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG
GTGCGTTCATTTCAAAGCTTTGGATTGATAGACCCTCGTGGTATTGTATTGACTTCCTCTACTAATTATTAGGAT
AATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCGGGT
AATAAAGTAAGTTACAACACTTGATATCACAGGGGTAAAGACCAACATACTATGTTTTCTCTCATCTAGGAAAAT
GGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCTATAACTCACTTCCCT
CAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAACACTGGTTATGTCGTA
ACGTACGTGAAACTGTTTCTTCAAACTTGCCGAATCCATTTATCCGTTCCATTTTTTTTTATTAGGTTCTGCCCT
TCAGGAGTGTTTCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail