© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|105620 |
| Gene name | |
| Location | scaffold_7:2161876..2162644 |
| Strand | - |
| Gene length (bp) | 768 |
| Transcript length (bp) | 570 |
| Coding sequence length (bp) | 570 |
| Protein length (aa) | 190 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 27 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 6.69 | 2.44 | 10.94 |
| Initials | Initials knots | 10.69 | 4.26 | 17.12 |
| Pileal_Stipeal_center | Stage I stipe center | 7.06 | 2.56 | 11.56 |
| Pileal_Stipeal_shell | Stage I stipe shell | 5.30 | 1.81 | 8.79 |
| DIF_stipe_center | Stage II stipe center | 19.44 | 8.91 | 29.98 |
| DIF_stipe_shell | Stage II stipe shell | 10.52 | 4.34 | 16.70 |
| DIF_stipe_skin | Stage II stipe skin | 8.24 | 3.21 | 13.27 |
| DIF_cap_skin | Stage II cap skin | 6.26 | 2.25 | 10.26 |
| DIF_cap_tissue | Stage II cap tissue | 6.62 | 2.08 | 11.17 |
| DIF_gill_tissue | Stage II gill tissue | 12.52 | 5.04 | 20.00 |
| YFB_stipe_center | Young fruiting body stipe center | 64.40 | 34.66 | 94.15 |
| YFB_stipe_shell | Young fruiting body stipe shell | 66.18 | 35.55 | 96.81 |
| YFB_stipe_skin | Young fruiting body stipe skin | 16.17 | 7.18 | 25.16 |
| YFB_cap_skin | Young fruiting body cap skin | 7.02 | 2.53 | 11.50 |
| YFB_cap_tissue | Young fruiting body cap tissue | 12.21 | 5.11 | 19.30 |
| YFB_gill_tissue | Young fruiting body gill tissue | 9.77 | 3.86 | 15.67 |
| YFB_veil | Young fruiting body veil | 9.55 | 3.73 | 15.37 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.157303 | no |
| Casing | YFB_stipe_center | 0.000613 | yes |
| Casing | YFB_stipe_shell | 0.000613 | yes |
| Casing | YFB_stipe_skin | 0.025711 | yes |
| Casing | YFB_cap_skin | 0.956671 | no |
| Casing | YFB_cap_tissue | 0.173970 | no |
| Casing | YFB_gill_tissue | 0.485998 | no |
| Casing | YFB_veil | 0.514080 | no |
| Casing | Initials | 0.342014 | no |
| Casing | Pileal_Stipeal_center | 0.951865 | no |
| Casing | Pileal_Stipeal_shell | 0.731782 | no |
| Casing | DIF_stipe_center | 0.008121 | yes |
| Casing | DIF_stipe_shell | 0.350999 | no |
| Casing | DIF_stipe_skin | 0.755783 | no |
| Casing | DIF_cap_skin | 0.939352 | no |
| Casing | DIF_cap_tissue | 0.989009 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.643093 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.200802 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.973088 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.676195 | no |
| DIF_gill_tissue | YFB_veil | 0.632718 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.964040 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.041824 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.583676 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.244275 | no |
| YFB_stipe_skin | YFB_veil | 0.217538 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.226152 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.561199 | no |
| YFB_cap_skin | YFB_veil | 0.592716 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.710849 | no |
| YFB_cap_tissue | YFB_veil | 0.670534 | no |
| YFB_gill_tissue | YFB_veil | 0.978438 | no |
| Initials | DIF_gill_tissue | 0.815262 | no |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.370023 | no |
| Initials | YFB_cap_skin | 0.407377 | no |
| Initials | YFB_cap_tissue | 0.847331 | no |
| Initials | YFB_gill_tissue | 0.907456 | no |
| Initials | YFB_veil | 0.878139 | no |
| Initials | Pileal_Stipeal_center | 0.412746 | no |
| Initials | Pileal_Stipeal_shell | 0.102020 | no |
| Initials | DIF_stipe_center | 0.138143 | no |
| Initials | DIF_stipe_shell | 0.984130 | no |
| Initials | DIF_stipe_skin | 0.652236 | no |
| Initials | DIF_cap_skin | 0.250478 | no |
| Initials | DIF_cap_tissue | 0.358057 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.204814 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.033674 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.995987 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.224134 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.565243 | no |
| Pileal_Stipeal_center | YFB_veil | 0.598545 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.643574 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.009123 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.428168 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.829297 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.878029 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.942986 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.036455 | yes |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.003365 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.656991 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.039836 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.176313 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.197235 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.108390 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.381638 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.823646 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.753475 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.331527 | no |
| DIF_stipe_center | YFB_stipe_center | 0.001625 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.001625 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.754255 | no |
| DIF_stipe_center | YFB_cap_skin | 0.010728 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.282209 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.084017 | no |
| DIF_stipe_center | YFB_veil | 0.070499 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.120676 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.024946 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.003765 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.013186 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.788165 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_skin | 0.339493 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.430398 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.819478 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.923966 | no |
| DIF_stipe_shell | YFB_veil | 0.895878 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.676691 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.264512 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.373006 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.390956 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.089130 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.823199 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.419780 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.798950 | no |
| DIF_stipe_skin | YFB_veil | 0.831515 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.650717 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.752354 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.106349 | no |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.016949 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.885161 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.118699 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.385213 | no |
| DIF_cap_skin | YFB_veil | 0.412746 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.949958 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.172181 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.038278 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.949547 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.188530 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.492252 | no |
| DIF_cap_tissue | YFB_veil | 0.518458 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|105620 MMFHTLHRISSITTILLSITIAKSLATRHYEILNNCPQAIQIYINGESQGYIDAQTAISHNYQDDFSGFIYSDAN GGVVDDASANGTTSIGTTRAAFKGTDNYYYILSDKLNTGISIVPVSVNLAGNKENGFCVPIFCDMNSCPHSTDKP ITHFPQHHDHDHPPQSPLFECPDKNTGYVVTFCPSGVFP* |
| Coding | >AgabiH97|105620 ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG GATAATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCG GGTAATAAAGAAAATGGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCT ATAACTCACTTCCCTCAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAAC ACTGGTTATGTCGTAACGTTCTGCCCTTCAGGAGTGTTTCCCTAA |
| Transcript | >AgabiH97|105620 ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG GATAATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCG GGTAATAAAGAAAATGGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCT ATAACTCACTTCCCTCAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAAC ACTGGTTATGTCGTAACGTTCTGCCCTTCAGGAGTGTTTCCCTAA |
| Gene | >AgabiH97|105620 ATGATGTTCCACACTTTACATCGAATCTCCTCCATCACCACCATCCTCCTCTCCATCACCATTGCCAAAAGTCTA GCCACTCGCCACTACGAAATCCTCAACAATTGCCCACAAGCCATTCAAATCTACATCAACGGTGAAAGTCAAGGT TACATCGACGCCCAAACGGCGATTAGCCATAATTATCAAGATGATTTTAGTGGATTTATCTATTCTGATGCGAAT GGAGGTGTGGTAGATGATGCTAGTGCGAATGGTACTACTAGTATTGGTACTACTCGCGCTGCGTTCAAGGGCACG GTGCGTTCATTTCAAAGCTTTGGATTGATAGACCCTCGTGGTATTGTATTGACTTCCTCTACTAATTATTAGGAT AATTATTACTACATTCTATCGGACAAATTGAACACTGGAATCAGTATCGTCCCAGTCTCTGTCAACTTGGCGGGT AATAAAGTAAGTTACAACACTTGATATCACAGGGGTAAAGACCAACATACTATGTTTTCTCTCATCTAGGAAAAT GGTTTCTGCGTCCCCATTTTCTGCGACATGAATTCTTGTCCACATTCAACTGATAAACCTATAACTCACTTCCCT CAACATCATGATCATGATCACCCACCCCAATCGCCTCTATTCGAATGTCCTGACAAAAACACTGGTTATGTCGTA ACGTACGTGAAACTGTTTCTTCAAACTTGCCGAATCCATTTATCCGTTCCATTTTTTTTTATTAGGTTCTGCCCT TCAGGAGTGTTTCCCTAA |