Protein ID | AgabiH97|105250 |
Gene name | |
Location | scaffold_7:2051335..2052687 |
Strand | + |
Gene length (bp) | 1352 |
Transcript length (bp) | 1047 |
Coding sequence length (bp) | 1047 |
Protein length (aa) | 349 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01095 | Pectinesterase | Pectinesterase | 3.6E-36 | 51 | 334 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P17872|PME_ASPTU | Pectinesterase OS=Aspergillus tubingensis GN=pme1 PE=1 SV=1 | 25 | 347 | 1.0E-70 |
sp|Q12535|PME_ASPAC | Pectinesterase OS=Aspergillus aculeatus GN=pme1 PE=2 SV=1 | 32 | 347 | 4.0E-66 |
sp|Q5B7U0|PMEA_EMENI | Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pmeA PE=1 SV=1 | 35 | 346 | 8.0E-63 |
sp|A2QK82|PMEA_ASPNC | Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pmeA PE=3 SV=1 | 35 | 346 | 1.0E-61 |
sp|A1DBT4|PMEA_NEOFI | Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pmeA PE=3 SV=1 | 34 | 346 | 5.0E-61 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P17872|PME_ASPTU | Pectinesterase OS=Aspergillus tubingensis GN=pme1 PE=1 SV=1 | 25 | 347 | 1.0E-70 |
sp|Q12535|PME_ASPAC | Pectinesterase OS=Aspergillus aculeatus GN=pme1 PE=2 SV=1 | 32 | 347 | 4.0E-66 |
sp|Q5B7U0|PMEA_EMENI | Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pmeA PE=1 SV=1 | 35 | 346 | 8.0E-63 |
sp|A2QK82|PMEA_ASPNC | Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pmeA PE=3 SV=1 | 35 | 346 | 1.0E-61 |
sp|A1DBT4|PMEA_NEOFI | Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pmeA PE=3 SV=1 | 34 | 346 | 5.0E-61 |
sp|Q4WBT5|PMEA_ASPFU | Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmeA PE=3 SV=1 | 34 | 346 | 5.0E-58 |
sp|B0Y9F9|PMEA_ASPFC | Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pmeA PE=3 SV=1 | 34 | 346 | 5.0E-58 |
sp|B8NPS7|PMEA_ASPFN | Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pmeA PE=3 SV=1 | 25 | 346 | 6.0E-58 |
sp|Q2UBD9|PMEA_ASPOR | Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pmeA PE=3 SV=1 | 36 | 346 | 8.0E-58 |
sp|Q9LVQ0|PME31_ARATH | Pectinesterase 31 OS=Arabidopsis thaliana GN=PME31 PE=1 SV=1 | 41 | 337 | 2.0E-34 |
sp|Q5MFV6|PME37_ARATH | Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana GN=VGDH2 PE=2 SV=2 | 53 | 342 | 5.0E-30 |
sp|Q9ZQA3|PME15_ARATH | Probable pectinesterase 15 OS=Arabidopsis thaliana GN=PME15 PE=2 SV=1 | 43 | 337 | 1.0E-29 |
sp|Q84WM7|PPME1_ARATH | Pectinesterase PPME1 OS=Arabidopsis thaliana GN=PPME1 PE=1 SV=1 | 54 | 328 | 7.0E-29 |
sp|B2VPR8|AL11B_OLEEU | Pectinesterase 2 OS=Olea europaea PE=1 SV=1 | 43 | 342 | 2.0E-27 |
sp|Q9LY19|PME48_ARATH | Probable pectinesterase 48 OS=Arabidopsis thaliana GN=PME48 PE=2 SV=2 | 54 | 328 | 4.0E-27 |
sp|D8VPP5|AL11A_OLEEU | Pectinesterase 1 OS=Olea europaea PE=1 SV=1 | 45 | 342 | 5.0E-27 |
sp|Q9SIJ9|PME11_ARATH | Putative pectinesterase 11 OS=Arabidopsis thaliana GN=PME11 PE=3 SV=1 | 43 | 335 | 6.0E-27 |
sp|Q9FKF3|PME63_ARATH | Putative pectinesterase 63 OS=Arabidopsis thaliana GN=PME63 PE=3 SV=2 | 48 | 331 | 6.0E-27 |
sp|Q9LY18|PME49_ARATH | Probable pectinesterase 49 OS=Arabidopsis thaliana GN=PME49 PE=2 SV=1 | 45 | 328 | 3.0E-26 |
sp|O48711|PME12_ARATH | Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana GN=PME12 PE=2 SV=1 | 40 | 316 | 3.0E-26 |
sp|Q8VYZ3|PME53_ARATH | Probable pectinesterase 53 OS=Arabidopsis thaliana GN=PME53 PE=2 SV=1 | 30 | 344 | 2.0E-25 |
sp|O04887|PME2_CITSI | Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE=2 SV=1 | 36 | 342 | 2.0E-25 |
sp|Q5MFV8|PME5_ARATH | Pectinesterase 5 OS=Arabidopsis thaliana GN=PME5 PE=1 SV=2 | 53 | 335 | 2.0E-25 |
sp|O23038|PME8_ARATH | Probable pectinesterase 8 OS=Arabidopsis thaliana GN=PME8 PE=2 SV=2 | 56 | 324 | 3.0E-25 |
sp|P41510|PME_BRANA | Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus GN=BP19 PE=2 SV=1 | 53 | 342 | 7.0E-25 |
sp|Q7Y201|PME13_ARATH | Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana GN=PME13 PE=2 SV=2 | 53 | 340 | 8.0E-25 |
sp|Q9FJ21|PME58_ARATH | Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana GN=PME58 PE=2 SV=1 | 53 | 329 | 9.0E-25 |
sp|Q8LPF3|PME68_ARATH | Probable pectinesterase 68 OS=Arabidopsis thaliana GN=PME68 PE=2 SV=1 | 40 | 334 | 1.0E-24 |
sp|Q8RXK7|PME41_ARATH | Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana GN=PME41 PE=2 SV=2 | 45 | 337 | 5.0E-24 |
sp|Q9LY17|PME50_ARATH | Probable pectinesterase 50 OS=Arabidopsis thaliana GN=PME50 PE=2 SV=1 | 41 | 328 | 1.0E-23 |
sp|Q42608|PME_BRACM | Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris PE=2 SV=1 | 53 | 342 | 1.0E-23 |
sp|O80722|PME4_ARATH | Pectinesterase 4 OS=Arabidopsis thaliana GN=PME4 PE=2 SV=1 | 53 | 325 | 2.0E-23 |
sp|Q1JPL7|PME18_ARATH | Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana GN=PME18 PE=1 SV=3 | 31 | 334 | 2.0E-23 |
sp|Q9FM79|PME62_ARATH | Pectinesterase QRT1 OS=Arabidopsis thaliana GN=QRT1 PE=2 SV=1 | 45 | 328 | 4.0E-23 |
sp|Q4PT34|PME56_ARATH | Probable pectinesterase 56 OS=Arabidopsis thaliana GN=PME56 PE=2 SV=1 | 34 | 284 | 5.0E-23 |
sp|Q9SMY6|PME45_ARATH | Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana GN=PME45 PE=2 SV=1 | 53 | 330 | 1.0E-22 |
sp|Q9ZQA4|PME14_ARATH | Putative pectinesterase 14 OS=Arabidopsis thaliana GN=PME14 PE=2 SV=1 | 39 | 329 | 3.0E-22 |
sp|P83218|PME_DAUCA | Pectinesterase OS=Daucus carota PE=1 SV=1 | 53 | 316 | 4.0E-22 |
sp|Q96575|PME22_SOLLC | Pectinesterase 2.2 OS=Solanum lycopersicum GN=PME2.2 PE=3 SV=1 | 53 | 316 | 5.0E-22 |
sp|Q9LSP1|PME67_ARATH | Probable pectinesterase 67 OS=Arabidopsis thaliana GN=PME67 PE=2 SV=1 | 14 | 328 | 8.0E-22 |
sp|O04953|PME52_ARATH | Putative pectinesterase 52 OS=Arabidopsis thaliana GN=PME52 PE=2 SV=2 | 124 | 342 | 1.0E-21 |
sp|Q9SRX4|PME7_ARATH | Probable pectinesterase/pectinesterase inhibitor 7 OS=Arabidopsis thaliana GN=PME7 PE=2 SV=1 | 45 | 316 | 1.0E-21 |
sp|Q9SG77|PME24_ARATH | Putative pectinesterase/pectinesterase inhibitor 24 OS=Arabidopsis thaliana GN=PME24 PE=3 SV=1 | 53 | 342 | 2.0E-21 |
sp|Q1PEC0|PME42_ARATH | Probable pectinesterase/pectinesterase inhibitor 42 OS=Arabidopsis thaliana GN=PME42 PE=2 SV=1 | 53 | 342 | 3.0E-21 |
sp|Q43043|PME_PETIN | Pectinesterase OS=Petunia integrifolia GN=PPE1 PE=2 SV=1 | 53 | 316 | 4.0E-21 |
sp|O49298|PME6_ARATH | Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana GN=PME6 PE=2 SV=1 | 31 | 316 | 4.0E-21 |
sp|P14280|PME1_SOLLC | Pectinesterase 1 OS=Solanum lycopersicum GN=PME1.9 PE=1 SV=5 | 53 | 316 | 6.0E-21 |
sp|Q43143|PMEU1_SOLLC | Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum GN=PMEU1 PE=2 SV=1 | 53 | 329 | 7.0E-21 |
sp|Q9LYT5|PME35_ARATH | Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana GN=PME35 PE=2 SV=1 | 53 | 342 | 7.0E-21 |
sp|Q3E9D3|PME55_ARATH | Probable pectinesterase 55 OS=Arabidopsis thaliana GN=PME55 PE=2 SV=1 | 22 | 343 | 1.0E-20 |
sp|Q8GXA1|PME23_ARATH | Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana GN=PME23 PE=2 SV=3 | 31 | 329 | 2.0E-20 |
sp|Q43062|PME_PRUPE | Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica PE=2 SV=1 | 53 | 334 | 2.0E-20 |
sp|P83948|PME3_CITSI | Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1 | 53 | 316 | 3.0E-20 |
sp|Q96576|PME3_SOLLC | Pectinesterase 3 OS=Solanum lycopersicum GN=PME3 PE=3 SV=1 | 53 | 316 | 3.0E-20 |
sp|Q9LXK7|PME32_ARATH | Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana GN=PME32 PE=2 SV=1 | 53 | 334 | 3.0E-20 |
sp|P09607|PME21_SOLLC | Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2.1 PE=2 SV=2 | 53 | 316 | 3.0E-20 |
sp|Q9M9W7|PME22_ARATH | Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana GN=PME22 PE=3 SV=1 | 53 | 316 | 4.0E-20 |
sp|Q3EAY9|PME30_ARATH | Probable pectinesterase 30 OS=Arabidopsis thaliana GN=PME30 PE=2 SV=1 | 53 | 316 | 4.0E-20 |
sp|Q84JX1|PME19_ARATH | Probable pectinesterase/pectinesterase inhibitor 19 OS=Arabidopsis thaliana GN=PME19 PE=2 SV=1 | 53 | 342 | 7.0E-20 |
sp|Q3E8Z8|PME28_ARATH | Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1 | 53 | 342 | 7.0E-20 |
sp|O64479|PME10_ARATH | Putative pectinesterase 10 OS=Arabidopsis thaliana GN=PME10 PE=2 SV=1 | 24 | 329 | 9.0E-20 |
sp|Q84R10|PME36_ARATH | Probable pectinesterase/pectinesterase inhibitor 36 OS=Arabidopsis thaliana GN=PME36 PE=2 SV=2 | 37 | 344 | 1.0E-19 |
sp|Q4PSN0|PME29_ARATH | Probable pectinesterase 29 OS=Arabidopsis thaliana GN=PME29 PE=2 SV=1 | 21 | 323 | 1.0E-19 |
sp|Q4PSQ5|PME66_ARATH | Probable pectinesterase 66 OS=Arabidopsis thaliana GN=PME66 PE=2 SV=2 | 24 | 337 | 2.0E-19 |
sp|Q8L7Q7|PME64_ARATH | Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana GN=PME64 PE=2 SV=2 | 55 | 337 | 2.0E-19 |
sp|Q43111|PME3_PHAVU | Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1 | 53 | 334 | 3.0E-19 |
sp|Q9LUL8|PME26_ARATH | Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana GN=PME26 PE=2 SV=1 | 53 | 316 | 4.0E-19 |
sp|O22149|PME17_ARATH | Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana GN=PME17 PE=2 SV=2 | 37 | 342 | 5.0E-19 |
sp|P83947|PME1_FICPW | Pectinesterase/pectinesterase inhibitor OS=Ficus pumila var. awkeotsang PE=1 SV=1 | 53 | 334 | 9.0E-19 |
sp|Q42920|PME_MEDSA | Pectinesterase/pectinesterase inhibitor OS=Medicago sativa PE=2 SV=1 | 53 | 328 | 1.0E-18 |
sp|Q94CB1|PME25_ARATH | Probable pectinesterase/pectinesterase inhibitor 25 OS=Arabidopsis thaliana GN=PME25 PE=2 SV=1 | 52 | 317 | 1.0E-18 |
sp|Q9FF78|PME46_ARATH | Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana GN=PME46 PE=2 SV=1 | 53 | 331 | 2.0E-18 |
sp|Q9SMY7|PME44_ARATH | Probable pectinesterase/pectinesterase inhibitor 44 OS=Arabidopsis thaliana GN=PME44 PE=2 SV=2 | 53 | 334 | 3.0E-18 |
sp|Q9FF77|PME47_ARATH | Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana GN=PME47 PE=2 SV=1 | 42 | 347 | 4.0E-18 |
sp|Q8GX86|PME21_ARATH | Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2 | 53 | 342 | 4.0E-18 |
sp|Q43867|PME1_ARATH | Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 PE=1 SV=1 | 53 | 338 | 2.0E-17 |
sp|O04886|PME1_CITSI | Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1 | 31 | 316 | 2.0E-17 |
sp|O22256|PME20_ARATH | Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana GN=PME20 PE=2 SV=2 | 45 | 316 | 2.0E-17 |
sp|Q9LXD9|PME51_ARATH | Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana GN=PME51 PE=2 SV=1 | 56 | 344 | 1.0E-16 |
sp|O81415|PME39_ARATH | Probable pectinesterase/pectinesterase inhibitor 39 OS=Arabidopsis thaliana GN=PME39 PE=2 SV=1 | 53 | 343 | 2.0E-16 |
sp|P85076|PME_ACTDE | Pectinesterase OS=Actinidia deliciosa PE=1 SV=1 | 53 | 316 | 3.0E-16 |
sp|Q3E989|PME54_ARATH | Probable pectinesterase/pectinesterase inhibitor 54 OS=Arabidopsis thaliana GN=PME54 PE=2 SV=1 | 128 | 330 | 4.0E-16 |
sp|Q42534|PME2_ARATH | Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2 | 53 | 316 | 5.0E-16 |
sp|O49006|PME3_ARATH | Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana GN=PME3 PE=2 SV=2 | 53 | 316 | 1.0E-15 |
sp|O81320|PME38_ARATH | Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana GN=PME38 PE=3 SV=1 | 128 | 342 | 2.0E-15 |
sp|O81301|PME40_ARATH | Probable pectinesterase/pectinesterase inhibitor 40 OS=Arabidopsis thaliana GN=PME40 PE=2 SV=1 | 53 | 330 | 2.0E-15 |
sp|Q9SKX2|PME16_ARATH | Probable pectinesterase/pectinesterase inhibitor 16 OS=Arabidopsis thaliana GN=PME16 PE=2 SV=1 | 145 | 334 | 4.0E-15 |
sp|O23447|PME43_ARATH | Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana GN=PME43 PE=2 SV=1 | 53 | 329 | 6.0E-15 |
sp|Q9FHN4|PME60_ARATH | Probable pectinesterase/pectinesterase inhibitor 60 OS=Arabidopsis thaliana GN=PME60 PE=2 SV=1 | 53 | 316 | 2.0E-14 |
sp|Q9FHN5|PME59_ARATH | Probable pectinesterase/pectinesterase inhibitor 59 OS=Arabidopsis thaliana GN=PME59 PE=2 SV=1 | 53 | 316 | 3.0E-14 |
sp|Q9FK05|PME61_ARATH | Probable pectinesterase/pectinesterase inhibitor 61 OS=Arabidopsis thaliana GN=PME61 PE=2 SV=1 | 53 | 342 | 1.0E-13 |
sp|Q9STY3|PME33_ARATH | Probable pectinesterase/pectinesterase inhibitor 33 OS=Arabidopsis thaliana GN=PME33 PE=2 SV=1 | 53 | 342 | 2.0E-13 |
sp|Q9M3B0|PME34_ARATH | Probable pectinesterase/pectinesterase inhibitor 34 OS=Arabidopsis thaliana GN=PME34 PE=2 SV=1 | 53 | 334 | 1.0E-12 |
sp|P0C1A8|PMEA_DICCH | Pectinesterase A OS=Dickeya chrysanthemi GN=pemA PE=1 SV=1 | 26 | 335 | 1.0E-10 |
sp|P0C1A9|PMEA_DICD3 | Pectinesterase A OS=Dickeya dadantii (strain 3937) GN=pemA PE=1 SV=1 | 26 | 335 | 1.0E-10 |
sp|P58601|PME_RALSO | Pectinesterase OS=Ralstonia solanacearum (strain GMI1000) GN=pme PE=3 SV=1 | 53 | 241 | 4.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0042545 | cell wall modification | Yes |
GO:0030599 | pectinesterase activity | Yes |
GO:0003674 | molecular_function | No |
GO:0016043 | cellular component organization | No |
GO:0045229 | external encapsulating structure organization | No |
GO:0016787 | hydrolase activity | No |
GO:0071554 | cell wall organization or biogenesis | No |
GO:0003824 | catalytic activity | No |
GO:0008150 | biological_process | No |
GO:0016788 | hydrolase activity, acting on ester bonds | No |
GO:0009987 | cellular process | No |
GO:0071555 | cell wall organization | No |
GO:0052689 | carboxylic ester hydrolase activity | No |
GO:0071840 | cellular component organization or biogenesis | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 34 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 11.75 | 5.35 | 18.15 |
Initials | Initials knots | 17.90 | 9.19 | 26.61 |
Pileal_Stipeal_center | Stage I stipe center | 8.51 | 3.96 | 13.06 |
Pileal_Stipeal_shell | Stage I stipe shell | 5.67 | 2.46 | 8.88 |
DIF_stipe_center | Stage II stipe center | 5.60 | 2.42 | 8.78 |
DIF_stipe_shell | Stage II stipe shell | 8.42 | 3.90 | 12.95 |
DIF_stipe_skin | Stage II stipe skin | 9.81 | 4.67 | 14.95 |
DIF_cap_skin | Stage II cap skin | 3.87 | 1.57 | 6.17 |
DIF_cap_tissue | Stage II cap tissue | 3.22 | 1.16 | 5.28 |
DIF_gill_tissue | Stage II gill tissue | 4.01 | 1.63 | 6.38 |
YFB_stipe_center | Young fruiting body stipe center | 4.34 | 1.80 | 6.88 |
YFB_stipe_shell | Young fruiting body stipe shell | 5.63 | 2.44 | 8.82 |
YFB_stipe_skin | Young fruiting body stipe skin | 8.31 | 3.86 | 12.76 |
YFB_cap_skin | Young fruiting body cap skin | 3.09 | 1.20 | 4.99 |
YFB_cap_tissue | Young fruiting body cap tissue | 4.06 | 1.64 | 6.47 |
YFB_gill_tissue | Young fruiting body gill tissue | 3.48 | 1.38 | 5.58 |
YFB_veil | Young fruiting body veil | 3.87 | 1.55 | 6.18 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.004928 | yes |
Casing | YFB_stipe_center | 0.007439 | yes |
Casing | YFB_stipe_shell | 0.054776 | no |
Casing | YFB_stipe_skin | 0.459407 | no |
Casing | YFB_cap_skin | 0.000613 | yes |
Casing | YFB_cap_tissue | 0.004160 | yes |
Casing | YFB_gill_tissue | 0.000613 | yes |
Casing | YFB_veil | 0.002525 | yes |
Casing | Initials | 0.293773 | no |
Casing | Pileal_Stipeal_center | 0.499867 | no |
Casing | Pileal_Stipeal_shell | 0.055779 | no |
Casing | DIF_stipe_center | 0.050706 | no |
Casing | DIF_stipe_shell | 0.487786 | no |
Casing | DIF_stipe_skin | 0.752563 | no |
Casing | DIF_cap_skin | 0.002951 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.916603 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.515243 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.064520 | no |
DIF_gill_tissue | YFB_cap_skin | 0.661533 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.986731 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.846570 | no |
DIF_gill_tissue | YFB_veil | 0.965732 | no |
YFB_stipe_center | YFB_stipe_shell | 0.641435 | no |
YFB_stipe_center | YFB_stipe_skin | 0.095962 | no |
YFB_stipe_center | YFB_cap_skin | 0.513719 | no |
YFB_stipe_center | YFB_cap_tissue | 0.930942 | no |
YFB_stipe_center | YFB_gill_tissue | 0.713166 | no |
YFB_stipe_center | YFB_veil | 0.870259 | no |
YFB_stipe_shell | YFB_stipe_skin | 0.394895 | no |
YFB_stipe_shell | YFB_cap_skin | 0.167625 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.534315 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.297484 | no |
YFB_stipe_shell | YFB_veil | 0.452955 | no |
YFB_stipe_skin | YFB_cap_skin | 0.009446 | yes |
YFB_stipe_skin | YFB_cap_tissue | 0.069387 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.022369 | yes |
YFB_stipe_skin | YFB_veil | 0.049046 | yes |
YFB_cap_skin | YFB_cap_tissue | 0.645490 | no |
YFB_cap_skin | YFB_gill_tissue | 0.873781 | no |
YFB_cap_skin | YFB_veil | 0.722335 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.827012 | no |
YFB_cap_tissue | YFB_veil | 0.952745 | no |
YFB_gill_tissue | YFB_veil | 0.886997 | no |
Initials | DIF_gill_tissue | 0.000613 | yes |
Initials | YFB_stipe_center | 0.000613 | yes |
Initials | YFB_stipe_shell | 0.000613 | yes |
Initials | YFB_stipe_skin | 0.021846 | yes |
Initials | YFB_cap_skin | 0.000613 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.000613 | yes |
Initials | YFB_veil | 0.000613 | yes |
Initials | Pileal_Stipeal_center | 0.031557 | yes |
Initials | Pileal_Stipeal_shell | 0.001140 | yes |
Initials | DIF_stipe_center | 0.001140 | yes |
Initials | DIF_stipe_shell | 0.031800 | yes |
Initials | DIF_stipe_skin | 0.074478 | no |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.053358 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.084184 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.358922 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.973755 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.006032 | yes |
Pileal_Stipeal_center | YFB_cap_tissue | 0.056760 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 0.017507 | yes |
Pileal_Stipeal_center | YFB_veil | 0.037593 | yes |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.365235 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.351745 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.989345 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.814343 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.039836 | yes |
Pileal_Stipeal_center | DIF_cap_tissue | 0.013186 | yes |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.501599 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.630233 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.992680 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.409764 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.161831 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.526593 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.288884 | no |
Pileal_Stipeal_shell | YFB_veil | 0.444283 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.987145 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.394416 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.167242 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.437079 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.211586 | no |
DIF_stipe_center | DIF_gill_tissue | 0.518332 | no |
DIF_stipe_center | YFB_stipe_center | 0.644700 | no |
DIF_stipe_center | YFB_stipe_shell | 0.994313 | no |
DIF_stipe_center | YFB_stipe_skin | 0.387851 | no |
DIF_stipe_center | YFB_cap_skin | 0.170490 | no |
DIF_stipe_center | YFB_cap_tissue | 0.542444 | no |
DIF_stipe_center | YFB_gill_tissue | 0.299743 | no |
DIF_stipe_center | YFB_veil | 0.461332 | no |
DIF_stipe_center | DIF_stipe_shell | 0.370496 | no |
DIF_stipe_center | DIF_stipe_skin | 0.154787 | no |
DIF_stipe_center | DIF_cap_skin | 0.453914 | no |
DIF_stipe_center | DIF_cap_tissue | 0.223939 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.057550 | no |
DIF_stipe_shell | YFB_stipe_center | 0.090658 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.379207 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.984333 | no |
DIF_stipe_shell | YFB_cap_skin | 0.008457 | yes |
DIF_stipe_shell | YFB_cap_tissue | 0.060104 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.017783 | yes |
DIF_stipe_shell | YFB_veil | 0.040947 | yes |
DIF_stipe_shell | DIF_stipe_skin | 0.802540 | no |
DIF_stipe_shell | DIF_cap_skin | 0.042692 | yes |
DIF_stipe_shell | DIF_cap_tissue | 0.016104 | yes |
DIF_stipe_skin | DIF_gill_tissue | 0.015242 | yes |
DIF_stipe_skin | YFB_stipe_center | 0.022631 | yes |
DIF_stipe_skin | YFB_stipe_shell | 0.163031 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.778227 | no |
DIF_stipe_skin | YFB_cap_skin | 0.003365 | yes |
DIF_stipe_skin | YFB_cap_tissue | 0.017226 | yes |
DIF_stipe_skin | YFB_gill_tissue | 0.005302 | yes |
DIF_stipe_skin | YFB_veil | 0.010093 | yes |
DIF_stipe_skin | DIF_cap_skin | 0.011350 | yes |
DIF_stipe_skin | DIF_cap_tissue | 0.003365 | yes |
DIF_cap_skin | DIF_gill_tissue | 0.965833 | no |
DIF_cap_skin | YFB_stipe_center | 0.872062 | no |
DIF_cap_skin | YFB_stipe_shell | 0.455910 | no |
DIF_cap_skin | YFB_stipe_skin | 0.049257 | yes |
DIF_cap_skin | YFB_cap_skin | 0.715966 | no |
DIF_cap_skin | YFB_cap_tissue | 0.953485 | no |
DIF_cap_skin | YFB_gill_tissue | 0.885067 | no |
DIF_cap_skin | YFB_veil | 0.996774 | no |
DIF_cap_skin | DIF_cap_tissue | 0.787885 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.733426 | no |
DIF_cap_tissue | YFB_stipe_center | 0.595830 | no |
DIF_cap_tissue | YFB_stipe_shell | 0.217760 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.016104 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.962170 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.714955 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.923797 | no |
DIF_cap_tissue | YFB_veil | 0.786338 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|105250 MWTPAVNIPLQKDMAHLSICLAFCLLLLEVVLAASRTSPPAGALVVRARTSNSGEFSTVSAAVASLPNDSSSRTI FIYPGTYNEQVFITRSGPLTIYGYTTDTSTYRNNQVNIQAGVPASQAGSNDASGTLRVHKDNFKLYNVNVKNTFG QGSQAIAISQYGSRVGLYACGFYGYQDTLYANEGTQVYLRGYIEGAVDFIFGRHGSAYYGGNTIAIKGAGWVTAS GRESDDGGSYVFNQNTITIASGASGESGKCYFGRPWGNYAKVIFKNTIVEAPFNKALWSEWNDGDARTDHVFVAD YNSSGSGVSGASRPSWVAQLSSSQANQYSISSAVGSDYASWVDMNYFV* |
Coding | >AgabiH97|105250 ATGTGGACGCCAGCTGTGAATATACCTCTGCAAAAGGACATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTA TTGCTTCTTGAAGTTGTTCTTGCGGCTTCCCGCACTTCACCTCCTGCAGGAGCCCTTGTTGTCAGAGCTCGAACG AGTAACTCTGGGGAATTCTCAACTGTGTCTGCAGCAGTTGCCTCTCTTCCGAACGATAGCAGCTCTCGGACCATT TTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATTACTCGTTCTGGACCTTTGACGATCTACGGATATACG ACCGATACCTCCACTTATCGCAACAACCAAGTCAACATCCAAGCAGGTGTTCCTGCCAGCCAAGCCGGATCAAAC GATGCGAGTGGGACACTTCGCGTTCACAAGGATAACTTCAAGCTCTACAATGTCAATGTGAAGAACACCTTCGGA CAGGGCAGTCAGGCTATTGCCATCAGTCAATATGGAAGTCGTGTTGGTCTATACGCTTGTGGATTCTACGGTTAT CAGGATACTCTTTATGCAAACGAGGGAACCCAAGTTTATCTTCGAGGATACATTGAGGGGGCAGTCGATTTTATC TTCGGAAGACACGGTTCTGCATACTACGGCGGAAATACTATTGCAATCAAAGGTGCCGGATGGGTGACCGCAAGT GGTCGCGAGTCAGATGACGGAGGAAGTTATGTCTTCAACCAGAACACGATTACAATCGCGTCAGGCGCTTCTGGT GAATCAGGGAAATGCTATTTCGGAAGACCATGGGGCAACTACGCCAAGGTCATCTTCAAGAACACAATTGTGGAA GCTCCATTCAATAAAGCCCTCTGGTCAGAATGGAACGATGGAGACGCTCGAACTGATCACGTCTTCGTGGCCGAT TACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAAGTCGCCCAAGCTGGGTTGCCCAACTCTCGTCCTCTCAAGCG AATCAGTATTCCATCTCCAGTGCCGTTGGAAGTGATTATGCTAGTTGGGTAGATATGAATTACTTCGTCTAA |
Transcript | >AgabiH97|105250 ATGTGGACGCCAGCTGTGAATATACCTCTGCAAAAGGACATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTA TTGCTTCTTGAAGTTGTTCTTGCGGCTTCCCGCACTTCACCTCCTGCAGGAGCCCTTGTTGTCAGAGCTCGAACG AGTAACTCTGGGGAATTCTCAACTGTGTCTGCAGCAGTTGCCTCTCTTCCGAACGATAGCAGCTCTCGGACCATT TTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATTACTCGTTCTGGACCTTTGACGATCTACGGATATACG ACCGATACCTCCACTTATCGCAACAACCAAGTCAACATCCAAGCAGGTGTTCCTGCCAGCCAAGCCGGATCAAAC GATGCGAGTGGGACACTTCGCGTTCACAAGGATAACTTCAAGCTCTACAATGTCAATGTGAAGAACACCTTCGGA CAGGGCAGTCAGGCTATTGCCATCAGTCAATATGGAAGTCGTGTTGGTCTATACGCTTGTGGATTCTACGGTTAT CAGGATACTCTTTATGCAAACGAGGGAACCCAAGTTTATCTTCGAGGATACATTGAGGGGGCAGTCGATTTTATC TTCGGAAGACACGGTTCTGCATACTACGGCGGAAATACTATTGCAATCAAAGGTGCCGGATGGGTGACCGCAAGT GGTCGCGAGTCAGATGACGGAGGAAGTTATGTCTTCAACCAGAACACGATTACAATCGCGTCAGGCGCTTCTGGT GAATCAGGGAAATGCTATTTCGGAAGACCATGGGGCAACTACGCCAAGGTCATCTTCAAGAACACAATTGTGGAA GCTCCATTCAATAAAGCCCTCTGGTCAGAATGGAACGATGGAGACGCTCGAACTGATCACGTCTTCGTGGCCGAT TACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAAGTCGCCCAAGCTGGGTTGCCCAACTCTCGTCCTCTCAAGCG AATCAGTATTCCATCTCCAGTGCCGTTGGAAGTGATTATGCTAGTTGGGTAGATATGAATTACTTCGTCTAA |
Gene | >AgabiH97|105250 ATGTGGACGCCAGCTGTGAATATACCTCTGCAAAAGGACATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTA TTGCTTCTTGAAGTTGTTCTTGCGGCTTCCCGCACTTCACCTCCTGCAGGAGCCCTTGTTGTCAGAGCTCGAACG AGTAACTCTGGGGAATTCTCAACTGTGTCTGCAGCAGTTGCCTCTCTTCCGAACGATAGCAGCTCTCGGACCATT TTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATTACTCGTTCTGGACCTTTGACGGTGGGTGCCTTTACT CAACGACAATGCTGACGCTCGCTCAATGTTAAACATGACTTAGATCTACGGATATACGACCGATACCTCCACTTA TCGCAACAACCAAGTCAACATCCAAGCAGGTGTTCCTGCCAGCCAAGCCGGATCAAACGATGCGAGTGGGACACT TCGCGTTCACAAGGATAACTTCAAGCTCTACAATGTCAATGTGAAGAACACCTTCGGACAGGGCAGTCAGGCTAT TGCCATCAGTCAATATGGAAGTCGTGTTGGTCTATACGCTTGTGGATTCTACGGTTATCAGGATACTCTTTATGC AAACGAGGGAACCCAAGTTTATCTTCGAGGATACATTGAGGTAAAGAAAAAGCTGTCAATCGCCAAGTATAACTT TCCACTGATCTTTTTTTGACCAGGGGGCAGTCGATTTTATCTTCGGAAGACACGGTTCTGCATACTACGGCGGAA ATACTATTGCAATCAAAGGTGCCGGATGGGTGACCGCAAGTGGTCGCGAGTCAGATGACGGAGGAAGTTGTCAGT AAACGGTGGTTCTATCTTCTCCACATCGTCACTGACTGACATGTGAGCATCGCTACCTATAAGATGTCTTCAACC AGAACACGATTACAATCGCGTCAGGCGCTTCTGGTGAATCAGGGAAATGCTATTTCGGAAGACCATGGGGCAGTA AGCCACGCCACATTTTTCTCATGCACTTACAACTTCTTACGAAAACCTACTTCCTTGTAGACTACGCCAAGTGAC TTTTCCTTCTAAAAATAATCATTCAAAGCATAAGTGACATGTTTTATCACAGGGTCATCTTCAAGAACACAATTG TGGAAGCTCCATTCAATAAAGCCCTCTGGTCAGAATGGAACGATGGAGACGCTCGAACTGATCACGTCTTCGTGG CCGATTACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAAGTCGCCCAAGCTGGGTTGCCCAACTCTCGTCCTCTC AAGCGAATCAGTATTCCATCTCCAGTGCCGTTGGAAGTGATTATGCTAGTTGGGTAGATATGAATTACTTCGTCT AA |