Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104980
Gene name
Locationscaffold_7:1967535..1968657
Strand+
Gene length (bp)1122
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 9.2E-10 90 214

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4729 0.5261 0.2179 0.0907 0.1785 0.0954 0.137 0.1634 0.0364 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup125
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016530
Agaricus bisporus var bisporus H39 AgabiH39|550200
Agaricus bisporus var bisporus H39 AgabiH39|504400
Agaricus bisporus var bisporus H39 AgabiH39|499500
Agaricus bisporus var bisporus H39 AgabiH39|445500
Agaricus bisporus var bisporus H39 AgabiH39|444600
Agaricus bisporus var bisporus H39 AgabiH39|442400
Agaricus bisporus var bisporus H39 AgabiH39|439000
Agaricus bisporus var bisporus H39 AgabiH39|445300
Agaricus bisporus var bisporus H39 AgabiH39|302200
Agaricus bisporus var bisporus H39 AgabiH39|299900
Agaricus bisporus var bisporus H39 AgabiH39|267800
Agaricus bisporus var bisporus H39 AgabiH39|228300
Agaricus bisporus var bisporus H39 AgabiH39|218600
Agaricus bisporus var bisporus H39 AgabiH39|218400
Agaricus bisporus var bisporus H39 AgabiH39|027490
Agaricus bisporus var bisporus H39 AgabiH39|366000
Agaricus bisporus var bisporus H97 AgabiH97|039170
Agaricus bisporus var bisporus H97 AgabiH97|079920
Agaricus bisporus var bisporus H97 AgabiH97|044760
Agaricus bisporus var bisporus H97 AgabiH97|044750
Agaricus bisporus var bisporus H97 AgabiH97|044710
Agaricus bisporus var bisporus H97 AgabiH97|039810
Agaricus bisporus var bisporus H97 AgabiH97|039800
Agaricus bisporus var bisporus H97 AgabiH97|036980
Agaricus bisporus var bisporus H97 AgabiH97|012590
Agaricus bisporus var bisporus H97 AgabiH97|035360
Agaricus bisporus var bisporus H97 AgabiH97|032400
Agaricus bisporus var bisporus H97 AgabiH97|030810
Agaricus bisporus var bisporus H97 AgabiH97|027490
Agaricus bisporus var bisporus H97 AgabiH97|025990
Agaricus bisporus var bisporus H97 AgabiH97|016530
Agaricus bisporus var bisporus H97 AgabiH97|104980 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|036400
Agaricus bisporus var bisporus H97 AgabiH97|105000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104980
MASTGGSAPPIFADAAKFNGTNWVTWNGLIRIAADLRGVFGYLDGTIPNPSPQNNITTTLTTTTAADTAPTVQTP
ADTPWESTTPSANEWRVRNAWTMGLLIYNTADPVGLGININGSAADAWKSYTDTYQITSEIALLNAEQDLRNIVF
SDGEDFVDFISRLHTKWSNATALGAQISDISFRTIILNALPRSWDPIVATLYTTQTSRDAINQLMTHWARISRDR
TNNPQTTTSALQTTSNNRGCQRSQNSNLLCTNSNCGRRGHMIENCYWPGGGKAGQFPVGFGKRRGTNNAATTNTD
QMSANSAANTTEQVFALVAHAQHDTVSEVPPSPNHPSSPSSDRYDVRPSCNTTPLTVTDKTVAMFITPSKILL*
Coding >AgabiH97|104980
ATGGCCAGCACGGGCGGTAGTGCACCTCCAATTTTCGCTGATGCAGCAAAATTCAACGGAACGAACTGGGTTACT
TGGAATGGGTTGATTAGGATAGCCGCCGACTTACGAGGCGTCTTTGGTTACCTCGATGGTACCATTCCCAACCCA
TCCCCACAGAATAACATTACTACAACTCTGACCACCACCACAGCAGCGGACACCGCTCCGACTGTTCAGACACCA
GCTGATACACCCTGGGAGTCGACCACCCCCTCCGCTAATGAGTGGCGTGTTCGAAACGCCTGGACGATGGGCTTG
CTCATATATAACACGGCCGACCCGGTAGGACTTGGCATAAACATCAACGGGTCAGCCGCAGATGCTTGGAAGTCG
TACACAGACACATACCAAATCACCTCCGAGATCGCTCTCCTTAACGCCGAGCAAGACCTTCGTAACATAGTCTTC
AGTGATGGGGAGGATTTTGTCGACTTCATCTCCCGCCTCCACACAAAGTGGTCGAACGCTACAGCTTTGGGCGCA
CAAATCAGTGATATATCGTTCAGGACTATCATCTTGAATGCATTGCCGCGTTCATGGGATCCTATCGTTGCCACC
CTTTATACCACTCAGACCTCCCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGCCGTGATCGT
ACTAACAACCCCCAAACTACCACTTCGGCACTCCAAACAACTTCTAATAACCGTGGTTGTCAGCGCTCGCAGAAC
TCCAACCTCTTGTGCACCAACTCCAACTGTGGTAGACGTGGCCACATGATCGAGAACTGCTATTGGCCGGGAGGG
GGGAAGGCAGGACAGTTCCCTGTAGGATTTGGAAAACGGAGAGGAACGAACAATGCCGCAACTACCAATACCGAC
CAAATGTCCGCTAACTCTGCAGCGAACACAACTGAACAAGTTTTTGCGCTCGTCGCCCATGCCCAGCACGACACA
GTCTCAGAGGTACCACCTTCCCCAAACCATCCTTCGTCACCCTCTTCTGACAGATACGATGTCAGGCCGTCCTGC
AATACCACCCCACTTACAGTGACGGACAAAACCGTTGCAATGTTTATAACACCTTCAAAGATACTATTATAG
Transcript >AgabiH97|104980
ATGGCCAGCACGGGCGGTAGTGCACCTCCAATTTTCGCTGATGCAGCAAAATTCAACGGAACGAACTGGGTTACT
TGGAATGGGTTGATTAGGATAGCCGCCGACTTACGAGGCGTCTTTGGTTACCTCGATGGTACCATTCCCAACCCA
TCCCCACAGAATAACATTACTACAACTCTGACCACCACCACAGCAGCGGACACCGCTCCGACTGTTCAGACACCA
GCTGATACACCCTGGGAGTCGACCACCCCCTCCGCTAATGAGTGGCGTGTTCGAAACGCCTGGACGATGGGCTTG
CTCATATATAACACGGCCGACCCGGTAGGACTTGGCATAAACATCAACGGGTCAGCCGCAGATGCTTGGAAGTCG
TACACAGACACATACCAAATCACCTCCGAGATCGCTCTCCTTAACGCCGAGCAAGACCTTCGTAACATAGTCTTC
AGTGATGGGGAGGATTTTGTCGACTTCATCTCCCGCCTCCACACAAAGTGGTCGAACGCTACAGCTTTGGGCGCA
CAAATCAGTGATATATCGTTCAGGACTATCATCTTGAATGCATTGCCGCGTTCATGGGATCCTATCGTTGCCACC
CTTTATACCACTCAGACCTCCCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGCCGTGATCGT
ACTAACAACCCCCAAACTACCACTTCGGCACTCCAAACAACTTCTAATAACCGTGGTTGTCAGCGCTCGCAGAAC
TCCAACCTCTTGTGCACCAACTCCAACTGTGGTAGACGTGGCCACATGATCGAGAACTGCTATTGGCCGGGAGGG
GGGAAGGCAGGACAGTTCCCTGTAGGATTTGGAAAACGGAGAGGAACGAACAATGCCGCAACTACCAATACCGAC
CAAATGTCCGCTAACTCTGCAGCGAACACAACTGAACAAGTTTTTGCGCTCGTCGCCCATGCCCAGCACGACACA
GTCTCAGAGGTACCACCTTCCCCAAACCATCCTTCGTCACCCTCTTCTGACAGATACGATGTCAGGCCGTCCTGC
AATACCACCCCACTTACAGTGACGGACAAAACCGTTGCAATGTTTATAACACCTTCAAAGATACTATTATAG
Gene >AgabiH97|104980
ATGGCCAGCACGGGCGGTAGTGCACCTCCAATTTTCGCTGATGCAGCAAAATTCAACGGAACGAACTGGGTTACT
TGGAATGGGTTGATTAGGATAGCCGCCGACTTACGAGGCGTCTTTGGTTACCTCGATGGTACCATTCCCAACCCA
TCCCCACAGAATAACATTACTACAACTCTGACCACCACCACAGCAGCGGACACCGCTCCGACTGTTCAGACACCA
GCTGATACACCCTGGGAGTCGACCACCCCCTCCGCTAATGAGTGGCGTGTTCGAAACGCCTGGACGATGGGCTTG
CTCATATATAACACGGCCGACCCGGTAGGACTTGGCATAAACATCAACGGGTCAGCCGCAGATGCTTGGAAGTCG
TACACAGACACATACCAAATCACCTCCGAGATCGCTCTCCTTAACGCCGAGCAAGACCTTCGTAACATAGTCTTC
AGTGATGGGGAGGATTTTGTCGACTTCATCTCCCGCCTCCACACAAAGTGGTCGAACGCTACAGCTTTGGGCGCA
CAAATCAGTGATATATCGTTCAGGACTATCATCTTGAATGCATTGCCGCGTTCATGGGATCCTATCGTTGCCACC
CTTTATACCACTCAGACCTCCCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGCCGTGATCGT
ACTAACAACCCCCAAACTACCACTTCGGCACTCCAAACAACTTCTAATAACCGTGGTTGTCAGCGCTCGCAGAAC
TCCAACCTCTTGTGCACCAACTCCAACTGTGGTAGACGTGGCCACATGATCGAGAACTGCTATTGGCCGGGAGGG
GGGAAGGCAGGACAGTTCCCTGTAGGATTTGGAAAACGGAGAGGAACGAACAATGCCGCAACTACCAATACCGAC
CAAATGTCCGCTAACTCTGCAGCGAACACAACTGAACAAGTTTTTGCGCTCGTCGCCCATGCCCAGCACGACACA
GTCTCAGAGGTACCACCTTCCCCAAACCATCCTTCGTCACCCTCTTCTGACAGATACGATGTCAGGCCGTCCTGC
AATACCACCCCACTTACAGTGACGGACAAAACCGTTGCAATGTTTATAACACCTTCAAAGATACTATTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail