Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104730
Gene name
Locationscaffold_7:1909751..1912612
Strand+
Gene length (bp)2861
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-12 80 278
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-16 93 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 2 307 1.0E-36
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 25 300 2.0E-22
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 14 300 4.0E-22
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 24 300 2.0E-21
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 14 300 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 2 307 1.0E-36
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 25 300 2.0E-22
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 14 300 4.0E-22
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 24 300 2.0E-21
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 14 300 2.0E-21
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 14 300 1.0E-19
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 28 296 1.0E-18
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 14 300 1.0E-18
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 487 667 2.0E-18
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 28 296 2.0E-18
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 28 296 2.0E-18
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 45 296 1.0E-15
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 45 296 1.0E-15
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 45 296 1.0E-15
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 44 296 3.0E-15
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 44 296 3.0E-15
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 14 300 5.0E-15
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 45 296 7.0E-15
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 44 300 2.0E-14
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 42 296 4.0E-13
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 42 296 3.0E-12
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 42 296 5.0E-12
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 45 212 9.0E-12
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 479 667 3.0E-11
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 473 667 1.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 26 289 1.0E-10
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 53 212 4.0E-09
sp|E8ZB61|GALT_PSEPU Gallate transporter OS=Pseudomonas putida GN=galT PE=3 SV=1 48 212 5.0E-09
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 49 320 2.0E-08
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 476 662 3.0E-08
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 474 665 7.0E-08
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 474 665 7.0E-08
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 102 292 9.0E-08
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 62 212 9.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 486 667 1.0E-07
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 474 665 2.0E-07
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 43 275 8.0E-07
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 91 299 1.0E-06
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 438 656 2.0E-06
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 23 298 2.0E-06
sp|Q3ZAV1|S22AC_RAT Solute carrier family 22 member 12 OS=Rattus norvegicus GN=Slc22a12 PE=2 SV=1 105 303 2.0E-06
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 62 212 4.0E-06
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 474 665 4.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 474 665 6.0E-06
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 61 288 8.0E-06
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 31 298 9.0E-06
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 19 309 1.0E-05
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 105 301 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 100 122 22
3 129 146 17
4 151 168 17
5 189 211 22
6 248 267 19
7 488 510 22
8 530 552 22
9 559 578 19
10 582 604 22
11 625 644 19
12 648 667 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104730
MAAIAPRVSILWSDTPMNNNHLDDDSVDVEEQRSLVDSDDGLDDERTPLDKTIDRIGMGTYQWALLSLCGFGWMA
DNMWIQAIAIILPRVQQHYSVPDSYIGSVSSSMFAGMMLGAVGWGTCSDLLGRSTAFNATLFFTSIFGFVASLVD
GFIPLCIALFFLGTAVGGSMPTDGTLLLEHMPKEKQYLVTALSIFFSFGSVLSAFVALIVLPGNSCPSNSSSAPA
SVLGLTDLVDCDVGTQNRGWKYLLMTLALITLSMFLARMVLFRLHESPRYLVHAGRPLEAVKSLKMISKFNGSDL
EIELDDVADHHPATTTTTTSALPPSQSLLHARPDSTVITGPMDDRKVDERVVFDAGDEAAGNAGSSSPTKNSTDR
STLVPSYDAVGETASNVLEGHSFITPLLSNKDILPREIPKRSNSDNEDEYKPNLGSSFSRRRSGSGGSSLNRRSS
MYGYKRKCSMLPRGARKPLAAWWDRVSMVLEPEWFRTTVLVWAVWGSMSLAFTMFNVFLPKLLELGPSSGEVAKK
TLEDNLWDVMIFTIGGTPGAILGAWLIESSLGRRLSLAASTFITAVFCVVFIMVESTWAVRLSTMGVSLSATAMW
AVLYGWTPEIFGTKVRGTACGIASALSRIGGMIAPLLGGTLLMISRAVPVYTSVGVFTVAGICVLLLREGEGASF
DRTGKGRRRATKVVVH*
Coding >AgabiH97|104730
ATGGCGGCAATAGCCCCGCGCGTTTCCATTCTCTGGTCCGATACCCCCATGAACAATAATCATCTCGACGACGAC
AGCGTCGACGTCGAAGAGCAACGGTCTCTCGTCGACTCGGACGACGGGCTCGACGATGAGCGCACTCCTCTCGAC
AAGACAATCGATAGAATAGGCATGGGCACCTACCAATGGGCTCTCCTCTCCCTCTGCGGCTTCGGTTGGATGGCT
GATAATATGTGGATCCAAGCCATAGCAATTATCCTTCCCCGCGTACAGCAACACTATTCTGTGCCCGATAGCTAT
ATTGGTAGCGTATCCTCCTCCATGTTCGCTGGCATGATGCTGGGCGCAGTGGGCTGGGGTACCTGTTCTGACCTT
CTGGGTCGCAGTACAGCGTTCAACGCCACGCTCTTCTTCACCTCCATCTTTGGTTTCGTTGCATCCCTGGTAGAT
GGATTCATTCCCCTCTGCATAGCCTTGTTTTTCCTCGGTACGGCTGTTGGCGGCTCAATGCCAACTGACGGCACA
CTTTTACTCGAACACATGCCAAAAGAAAAACAATACCTCGTCACCGCGCTCTCCATTTTCTTTTCATTTGGTTCC
GTCCTCTCCGCATTCGTTGCGCTAATCGTCCTTCCTGGGAATTCATGTCCCAGTAATAGTTCTTCAGCTCCAGCA
TCAGTCTTGGGTTTGACAGATTTGGTTGATTGTGACGTGGGGACGCAGAATAGGGGGTGGAAATACTTGCTGATG
ACTCTGGCGTTGATAACACTATCCATGTTCCTCGCTCGCATGGTCCTCTTTCGCCTTCACGAATCACCTCGTTAT
CTCGTACACGCCGGTAGACCCCTGGAAGCCGTCAAATCACTGAAAATGATTTCGAAATTCAATGGATCGGATTTG
GAAATCGAATTGGACGATGTGGCTGATCATCATCCTGCTACTACAACAACTACAACTTCAGCGCTTCCGCCTTCG
CAGTCATTATTGCATGCACGACCAGATTCGACTGTTATCACTGGACCCATGGATGATAGGAAAGTTGACGAGAGA
GTTGTGTTTGATGCTGGCGACGAAGCTGCTGGTAATGCTGGTTCAAGTTCGCCGACGAAGAATAGTACCGATAGA
TCAACACTCGTACCTTCATATGACGCTGTCGGTGAAACGGCCTCAAACGTCCTCGAAGGTCATTCTTTCATAACC
CCTCTCCTCTCCAACAAAGATATCCTCCCTCGGGAAATTCCGAAAAGATCAAATTCTGATAACGAGGATGAATAT
AAACCCAATCTGGGTTCGTCTTTCAGTCGGAGAAGGAGTGGTAGTGGTGGGAGTAGTCTTAATAGGAGGTCGTCG
ATGTATGGATATAAGAGGAAGTGTTCGATGTTACCGAGGGGGGCGAGGAAACCTTTGGCGGCGTGGTGGGATCGA
GTTAGTATGGTTCTCGAACCGGAATGGTTTAGGACTACGGTGTTGGTGTGGGCTGTGTGGGGTTCTATGTCCCTA
GCGTTTACGATGTTCAATGTGTTTTTACCTAAACTTTTAGAATTGGGTCCTTCGTCGGGAGAAGTGGCTAAGAAG
ACTTTAGAAGATAATTTATGGGATGTGATGATTTTTACTATTGGTGGAACACCTGGAGCTATTCTCGGGGCTTGG
CTCATTGAATCATCGCTCGGTAGACGATTATCACTCGCCGCGAGTACATTTATAACGGCCGTGTTTTGTGTGGTG
TTTATTATGGTTGAATCGACTTGGGCTGTGAGGTTAAGTACTATGGGAGTTAGTTTAAGTGCTACTGCAATGTGG
GCGGTGTTATATGGTTGGACACCAGAGATATTCGGAACGAAAGTACGAGGTACAGCATGTGGAATAGCTTCTGCT
CTATCAAGAATTGGAGGAATGATTGCACCTTTATTAGGAGGTACACTTTTGATGATAAGTAGAGCTGTACCGGTT
TATACGTCTGTGGGTGTGTTTACGGTGGCTGGGATTTGTGTTTTGTTGTTGAGGGAGGGGGAGGGTGCGAGTTTT
GATAGGACTGGGAAGGGGAGGAGGAGAGCGACGAAAGTTGTGGTTCATTAG
Transcript >AgabiH97|104730
ATGGCGGCAATAGCCCCGCGCGTTTCCATTCTCTGGTCCGATACCCCCATGAACAATAATCATCTCGACGACGAC
AGCGTCGACGTCGAAGAGCAACGGTCTCTCGTCGACTCGGACGACGGGCTCGACGATGAGCGCACTCCTCTCGAC
AAGACAATCGATAGAATAGGCATGGGCACCTACCAATGGGCTCTCCTCTCCCTCTGCGGCTTCGGTTGGATGGCT
GATAATATGTGGATCCAAGCCATAGCAATTATCCTTCCCCGCGTACAGCAACACTATTCTGTGCCCGATAGCTAT
ATTGGTAGCGTATCCTCCTCCATGTTCGCTGGCATGATGCTGGGCGCAGTGGGCTGGGGTACCTGTTCTGACCTT
CTGGGTCGCAGTACAGCGTTCAACGCCACGCTCTTCTTCACCTCCATCTTTGGTTTCGTTGCATCCCTGGTAGAT
GGATTCATTCCCCTCTGCATAGCCTTGTTTTTCCTCGGTACGGCTGTTGGCGGCTCAATGCCAACTGACGGCACA
CTTTTACTCGAACACATGCCAAAAGAAAAACAATACCTCGTCACCGCGCTCTCCATTTTCTTTTCATTTGGTTCC
GTCCTCTCCGCATTCGTTGCGCTAATCGTCCTTCCTGGGAATTCATGTCCCAGTAATAGTTCTTCAGCTCCAGCA
TCAGTCTTGGGTTTGACAGATTTGGTTGATTGTGACGTGGGGACGCAGAATAGGGGGTGGAAATACTTGCTGATG
ACTCTGGCGTTGATAACACTATCCATGTTCCTCGCTCGCATGGTCCTCTTTCGCCTTCACGAATCACCTCGTTAT
CTCGTACACGCCGGTAGACCCCTGGAAGCCGTCAAATCACTGAAAATGATTTCGAAATTCAATGGATCGGATTTG
GAAATCGAATTGGACGATGTGGCTGATCATCATCCTGCTACTACAACAACTACAACTTCAGCGCTTCCGCCTTCG
CAGTCATTATTGCATGCACGACCAGATTCGACTGTTATCACTGGACCCATGGATGATAGGAAAGTTGACGAGAGA
GTTGTGTTTGATGCTGGCGACGAAGCTGCTGGTAATGCTGGTTCAAGTTCGCCGACGAAGAATAGTACCGATAGA
TCAACACTCGTACCTTCATATGACGCTGTCGGTGAAACGGCCTCAAACGTCCTCGAAGGTCATTCTTTCATAACC
CCTCTCCTCTCCAACAAAGATATCCTCCCTCGGGAAATTCCGAAAAGATCAAATTCTGATAACGAGGATGAATAT
AAACCCAATCTGGGTTCGTCTTTCAGTCGGAGAAGGAGTGGTAGTGGTGGGAGTAGTCTTAATAGGAGGTCGTCG
ATGTATGGATATAAGAGGAAGTGTTCGATGTTACCGAGGGGGGCGAGGAAACCTTTGGCGGCGTGGTGGGATCGA
GTTAGTATGGTTCTCGAACCGGAATGGTTTAGGACTACGGTGTTGGTGTGGGCTGTGTGGGGTTCTATGTCCCTA
GCGTTTACGATGTTCAATGTGTTTTTACCTAAACTTTTAGAATTGGGTCCTTCGTCGGGAGAAGTGGCTAAGAAG
ACTTTAGAAGATAATTTATGGGATGTGATGATTTTTACTATTGGTGGAACACCTGGAGCTATTCTCGGGGCTTGG
CTCATTGAATCATCGCTCGGTAGACGATTATCACTCGCCGCGAGTACATTTATAACGGCCGTGTTTTGTGTGGTG
TTTATTATGGTTGAATCGACTTGGGCTGTGAGGTTAAGTACTATGGGAGTTAGTTTAAGTGCTACTGCAATGTGG
GCGGTGTTATATGGTTGGACACCAGAGATATTCGGAACGAAAGTACGAGGTACAGCATGTGGAATAGCTTCTGCT
CTATCAAGAATTGGAGGAATGATTGCACCTTTATTAGGAGGTACACTTTTGATGATAAGTAGAGCTGTACCGGTT
TATACGTCTGTGGGTGTGTTTACGGTGGCTGGGATTTGTGTTTTGTTGTTGAGGGAGGGGGAGGGTGCGAGTTTT
GATAGGACTGGGAAGGGGAGGAGGAGAGCGACGAAAGTTGTGGTTCATTAG
Gene >AgabiH97|104730
ATGGCGGCAATAGCCCCGCGCGTTTCCATTCTCTGGTCCGATACCCCCATGAACAATAATCATCTCGACGACGAC
AGCGTCGACGTCGAAGAGCAACGGTCTCTCGTCGACTCGGACGACGGGCTCGACGATGAGCGCACTCCTGTGGGT
CCTCTTTGAACTCGGTACCTCTGCTGGGCCTAGCCTTATGGCACCGTCAGCTCGACAAGACAATCGATAGAATAG
GCATGGGCACCTACCAATGGGCTCTCCTCTCCCTCTGCGGCTTCGGTGTGTCTCATTTGTGCTCTTATGACAATT
CAGATTCAGACTGACAAAACTACCAGGTTGGATGGCTGATAATGTACTCGCCTTATCGCTCTGGGCAGCACCTGC
TTATACTCATGTATCTATCTAGATGTGGATCCAAGCCATAGCAATTATCCTTCCCCGCGTACAGCAACACTATTC
TGGTACAATTCCTCCATACCGCCTCCAATGGAAGTGCTGACCCCCCCACGCTTCCAGTGCCCGATAGCTATATTG
GTAGCGTATCCTCCTCCATGTTCGCTGGCATGATGCTGGGCGCAGTGGGCTGGGGTACCTGTGCGTCTCCCCCTC
CTCCTTTTGCGCCGCCGTCGAACTCATATTCGCAGGTTCTGACCTTCTGGGTCGCAGTACAGCGTTCAACGCCAC
GCTCTTCTTCACCTCCATCTTTGGTTTCGTTGCATCCCTGGTAGATGGATTCATTCCCCTCTGCATAGCCTTGTT
TTTCCTCGGTACGGCTGTTGGCGTACGTCATTGCTCTTCATCACTTCCACCTGCCACGCGTGACGCTGTTCTATT
CTAGGGCTCAATGCCAACTGACGGCACACTTTTACTCGAACACATGCCAAAAGAAAAACAATACCTCGTCACCGC
GCTCTCCATTTTCTTTTCATTTGGTTCCGTCCTCTCCGCATTCGTTGCGCTAATCGTCCTTCCTGGGAATTCATG
TCCCAGTAATAGTTCTTCAGCTCCAGCATCAGTCTTGGGTTTGACAGATTTGGTTGATTGTGACGTGGGGACGCA
GAATAGGGGGTGGAAATACTTGCTGATGACTCTGGCGTTGATAGTACGTTAGATCCTTTCCTTCCCCAATATTCG
TTTGGCACCTCCATGGGTAAGCATGGACGGGCCAGATCGGTATTCCCATGCCAATTCTCCCTTATCTCTATCCCC
TCGTGGCCTTCAACTCGCCGTTCTCGACGAACTGTTATCCCGCTTTACCCATTTAACCCGTGTATCTACAGACAC
TATCCATGTTCCTCGCTCGCATGGTCCTCTTTCGCCTTCACGAATCACCTCGTTATCTCGTACACGCCGGTAGAC
CCCTGGAAGCCGTCAAATCACTGAAAATGATTTCGAAATTCAATGGATCGGATTTGGAAATCGAATTGGACGATG
TGGCTGATCATCATCCTGCTACTACAACAACTACAACTTCAGCGCTTCCGCCTTCGCAGTCATTATTGCATGCAC
GACCAGATTCGACTGTTATCACTGGACCCATGGATGATAGGAAAGTTGACGAGAGAGTTGTGTTTGATGCTGGCG
ACGAAGCTGCTGGTAATGCTGGTTCAAGTTCGCCGACGAAGAATAGTACCGATAGATCAACACTCGTACCTTCAT
ATGACGCTGTCGGTGAAACGGCCTCAAACGTCCTCGAAGGTCATTCTTTCATAACCCCTCTCCTCTCCAACAAAG
ATATCCTCCCTCGGGAAATTCCGAAAAGATCAAATTCTGATAACGAGGATGAATATAAACCCAATCTGGGTTCGT
CTTTCAGTCGGAGAAGGAGTGGTAGTGGTGGGAGTAGTCTTAATAGGAGGTCGTCGATGTATGGATATAAGAGGA
AGTGTTCGATGTTACCGAGGGGGGCGAGGAAACCTTTGGCGGCGTGGTGGGATCGAGTTAGTATGGTTCTCGAAC
CGGAATGGTTTAGGACTACGGTGTTGGTGTGGGCTGTGTGGGGTTCTATGTCCCTAGGTGAGTTATCCATACGTT
TAAACTTGAATTGATCGTTTCTGAATGAGGTTTTCTTTTCTTTTGTAGCGTTTACGATGTTCAATGTGTTTTTAC
CTAAACTTTTAGAATTGGGTCCTTCGTCGGGAGAAGTGGCTAAGAAGACTTTAGAAGATAATTTATGGGATGTGA
TGATTTTTACTATTGGTGGAACACCTGGAGCTATTGTACGTCTCATCCATCCCCCGCTTACAAAAAGATGCGCAT
ATACTTATTTCCAATCAATTTTTTCTTTATAGCTCGGGGCTTGGCTCATTGAATCATCGCTCGGTAGACGATTAT
CACTCGCCGCGAGTACATTTATAACGGCCGTGTTTTGTGTGGTGTTTATTATGGTTGAATCGACTTGGGCTGTGA
GGTTAAGTACTATGGGAGTTAGTTTAAGTGCTACTGTGAGTCCCCCTTTCCCCCCTTTCTTTGTTGGTCTTGAAT
GTATGACTAATATGATGGATTATGAAGGCAATGTGGGCGGTGTTATATGGTTGGACACCAGAGATATTCGGAACG
AAAGTACGAGGTACAGCATGTGGAATAGCTTCTGCTCTATCAAGAATGTACGTATCCCCTCTCCTCTCCTCTCAC
TATCACCCTAACACATCCTTTTCTTTTTCTTTTGGTTTTTGGATAGTGGAGGAATGATTGCACCTTTATTAGGAG
GTACACTTTTGATGATAAGTAGAGCTGTACCGGTTTATACGTCTGTGGGTGTGTTTACGGTGGCTGGGATTTGTG
TTTTGTTGTTGAGGGAGGGGGAGGGTGCGAGTTTTGATAGGACTGGGAAGGGGAGGAGGAGAGCGACGAAAGTTG
TGGTTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail