Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104670
Gene name
Locationscaffold_7:1900503..1901891
Strand-
Gene length (bp)1388
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 51.01 28.78 73.24
Initials Initials knots 29.67 16.00 43.34
Pileal_Stipeal_center Stage I stipe center 66.78 39.02 94.55
Pileal_Stipeal_shell Stage I stipe shell 57.01 32.81 81.22
DIF_stipe_center Stage II stipe center 74.95 44.36 105.54
DIF_stipe_shell Stage II stipe shell 86.99 51.89 122.10
DIF_stipe_skin Stage II stipe skin 70.29 41.45 99.13
DIF_cap_skin Stage II cap skin 75.74 44.86 106.62
DIF_cap_tissue Stage II cap tissue 77.37 45.90 108.84
DIF_gill_tissue Stage II gill tissue 64.22 37.59 90.86
YFB_stipe_center Young fruiting body stipe center 60.93 35.69 86.18
YFB_stipe_shell Young fruiting body stipe shell 78.22 46.49 109.95
YFB_stipe_skin Young fruiting body stipe skin 83.17 49.49 116.85
YFB_cap_skin Young fruiting body cap skin 89.31 53.21 125.42
YFB_cap_tissue Young fruiting body cap tissue 101.40 60.65 142.15
YFB_gill_tissue Young fruiting body gill tissue 71.80 41.87 101.73
YFB_veil Young fruiting body veil 70.55 41.66 99.43

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.539924 no
Casing YFB_stipe_center 0.669030 no
Casing YFB_stipe_shell 0.151786 no
Casing YFB_stipe_skin 0.083669 no
Casing YFB_cap_skin 0.037593 yes
Casing YFB_cap_tissue 0.008457 yes
Casing YFB_gill_tissue 0.303175 no
Casing YFB_veil 0.323963 no
Casing Initials 0.073585 no
Casing Pileal_Stipeal_center 0.449570 no
Casing Pileal_Stipeal_shell 0.821681 no
Casing DIF_stipe_center 0.218974 no
Casing DIF_stipe_shell 0.056170 no
Casing DIF_stipe_skin 0.333988 no
Casing DIF_cap_skin 0.200802 no
Casing DIF_cap_tissue 0.164893 no
DIF_gill_tissue YFB_stipe_center 0.922691 no
DIF_gill_tissue YFB_stipe_shell 0.609857 no
DIF_gill_tissue YFB_stipe_skin 0.454978 no
DIF_gill_tissue YFB_cap_skin 0.302600 no
DIF_gill_tissue YFB_cap_tissue 0.106659 no
DIF_gill_tissue YFB_gill_tissue 0.814343 no
DIF_gill_tissue YFB_veil 0.845051 no
YFB_stipe_center YFB_stipe_shell 0.479522 no
YFB_stipe_center YFB_stipe_skin 0.335056 no
YFB_stipe_center YFB_cap_skin 0.202921 no
YFB_stipe_center YFB_cap_tissue 0.063376 no
YFB_stipe_center YFB_gill_tissue 0.697517 no
YFB_stipe_center YFB_veil 0.730698 no
YFB_stipe_shell YFB_stipe_skin 0.904203 no
YFB_stipe_shell YFB_cap_skin 0.759404 no
YFB_stipe_shell YFB_cap_tissue 0.445142 no
YFB_stipe_shell YFB_gill_tissue 0.861100 no
YFB_stipe_shell YFB_veil 0.823331 no
YFB_stipe_skin YFB_cap_skin 0.891292 no
YFB_stipe_skin YFB_cap_tissue 0.598657 no
YFB_stipe_skin YFB_gill_tissue 0.735099 no
YFB_stipe_skin YFB_veil 0.683703 no
YFB_cap_skin YFB_cap_tissue 0.771994 no
YFB_cap_skin YFB_gill_tissue 0.559149 no
YFB_cap_skin YFB_veil 0.502497 no
YFB_cap_tissue YFB_gill_tissue 0.264512 no
YFB_cap_tissue YFB_veil 0.217760 no
YFB_gill_tissue YFB_veil 0.975985 no
Initials DIF_gill_tissue 0.004928 yes
Initials YFB_stipe_center 0.012880 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.001140 yes
Initials YFB_veil 0.001140 yes
Initials Pileal_Stipeal_center 0.003765 yes
Initials Pileal_Stipeal_shell 0.022111 yes
Initials DIF_stipe_center 0.001140 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.001140 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.945387 no
Pileal_Stipeal_center YFB_stipe_center 0.854052 no
Pileal_Stipeal_center YFB_stipe_shell 0.705361 no
Pileal_Stipeal_center YFB_stipe_skin 0.549195 no
Pileal_Stipeal_center YFB_cap_skin 0.385213 no
Pileal_Stipeal_center YFB_cap_tissue 0.153274 no
Pileal_Stipeal_center YFB_gill_tissue 0.890544 no
Pileal_Stipeal_center YFB_veil 0.918284 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.712513 no
Pileal_Stipeal_center DIF_stipe_center 0.799248 no
Pileal_Stipeal_center DIF_stipe_shell 0.448926 no
Pileal_Stipeal_center DIF_stipe_skin 0.926350 no
Pileal_Stipeal_center DIF_cap_skin 0.778800 no
Pileal_Stipeal_center DIF_cap_tissue 0.729074 no
Pileal_Stipeal_shell DIF_gill_tissue 0.799856 no
Pileal_Stipeal_shell YFB_stipe_center 0.900812 no
Pileal_Stipeal_shell YFB_stipe_shell 0.340545 no
Pileal_Stipeal_shell YFB_stipe_skin 0.221819 no
Pileal_Stipeal_shell YFB_cap_skin 0.129541 no
Pileal_Stipeal_shell YFB_cap_tissue 0.035309 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.543667 no
Pileal_Stipeal_shell YFB_veil 0.575999 no
Pileal_Stipeal_shell DIF_stipe_center 0.434476 no
Pileal_Stipeal_shell DIF_stipe_shell 0.163697 no
Pileal_Stipeal_shell DIF_stipe_skin 0.584875 no
Pileal_Stipeal_shell DIF_cap_skin 0.404742 no
Pileal_Stipeal_shell DIF_cap_tissue 0.358404 no
DIF_stipe_center DIF_gill_tissue 0.714283 no
DIF_stipe_center YFB_stipe_center 0.586451 no
DIF_stipe_center YFB_stipe_shell 0.937042 no
DIF_stipe_center YFB_stipe_skin 0.823354 no
DIF_stipe_center YFB_cap_skin 0.665514 no
DIF_stipe_center YFB_cap_tissue 0.345735 no
DIF_stipe_center YFB_gill_tissue 0.939352 no
DIF_stipe_center YFB_veil 0.908196 no
DIF_stipe_center DIF_stipe_shell 0.731444 no
DIF_stipe_center DIF_stipe_skin 0.902139 no
DIF_stipe_center DIF_cap_skin 0.985165 no
DIF_stipe_center DIF_cap_tissue 0.954733 no
DIF_stipe_shell DIF_gill_tissue 0.352257 no
DIF_stipe_shell YFB_stipe_center 0.251968 no
DIF_stipe_shell YFB_stipe_shell 0.817367 no
DIF_stipe_shell YFB_stipe_skin 0.931642 no
DIF_stipe_shell YFB_cap_skin 0.961017 no
DIF_stipe_shell YFB_cap_tissue 0.707211 no
DIF_stipe_shell YFB_gill_tissue 0.621333 no
DIF_stipe_shell YFB_veil 0.566769 no
DIF_stipe_shell DIF_stipe_skin 0.557994 no
DIF_stipe_shell DIF_cap_skin 0.743606 no
DIF_stipe_shell DIF_cap_tissue 0.790718 no
DIF_stipe_skin DIF_gill_tissue 0.853594 no
DIF_stipe_skin YFB_stipe_center 0.738373 no
DIF_stipe_skin YFB_stipe_shell 0.816463 no
DIF_stipe_skin YFB_stipe_skin 0.670322 no
DIF_stipe_skin YFB_cap_skin 0.501599 no
DIF_stipe_skin YFB_cap_tissue 0.223034 no
DIF_stipe_skin YFB_gill_tissue 0.970108 no
DIF_stipe_skin YFB_veil 0.994029 no
DIF_stipe_skin DIF_cap_skin 0.880284 no
DIF_stipe_skin DIF_cap_tissue 0.839352 no
DIF_cap_skin DIF_gill_tissue 0.685970 no
DIF_cap_skin YFB_stipe_center 0.558421 no
DIF_cap_skin YFB_stipe_shell 0.953699 no
DIF_cap_skin YFB_stipe_skin 0.843249 no
DIF_cap_skin YFB_cap_skin 0.686330 no
DIF_cap_skin YFB_cap_tissue 0.376462 no
DIF_cap_skin YFB_gill_tissue 0.921831 no
DIF_cap_skin YFB_veil 0.888180 no
DIF_cap_skin DIF_cap_tissue 0.969447 no
DIF_cap_tissue DIF_gill_tissue 0.633027 no
DIF_cap_tissue YFB_stipe_center 0.504798 no
DIF_cap_tissue YFB_stipe_shell 0.984005 no
DIF_cap_tissue YFB_stipe_skin 0.885247 no
DIF_cap_tissue YFB_cap_skin 0.735920 no
DIF_cap_tissue YFB_cap_tissue 0.419342 no
DIF_cap_tissue YFB_gill_tissue 0.883971 no
DIF_cap_tissue YFB_veil 0.847249 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104670
MRSNAFLLPSVVLIASTPSLCDFPACRSCGSEETLVAWVKRSERNVPPLGYGIPTSNGGSMLTKIPVTYPMGQGE
PLNIIISGNSDSRVLVDSPSDGGLQNYFQSLGFSGECLGQRESVHQAANLGDGHDFKNETAVIRWNYGDPELGAC
KETIQGGNHFRYWIQDGPQVNSGAIFLAASYEKPIAQQHDIIPNGYNLGRDWLVGNITQSSIPTLNLTNGTTYSG
STSSEGYTYKTDISYLSGYLEDTNYGINHNISVGVDGINSVDGLVAVFDVDITQVPPNTSAAWRPSLVSLWHLSC
YSFLISFFSFELLS*
Coding >AgabiH97|104670
ATGCGCTCAAATGCTTTTCTACTGCCATCTGTTGTGCTAATAGCCTCTACACCCTCGTTATGTGATTTTCCAGCT
TGCCGGAGTTGTGGCTCAGAGGAGACGCTTGTTGCTTGGGTTAAACGCTCAGAGCGCAACGTGCCACCCTTAGGA
TATGGGATTCCGACATCTAATGGAGGGAGTATGCTGACGAAAATTCCAGTGACTTATCCAATGGGGCAAGGGGAG
CCTCTAAACATCATCATCAGTGGTAACTCGGACTCCCGTGTGCTAGTCGACTCTCCGAGTGACGGTGGACTTCAG
AATTATTTTCAGTCACTAGGCTTTTCTGGTGAATGCCTCGGTCAACGTGAAAGTGTGCACCAAGCTGCTAACCTC
GGAGATGGGCATGACTTCAAGAATGAAACTGCCGTTATCAGGTGGAATTACGGTGATCCAGAGTTAGGCGCGTGT
AAGGAGACCATTCAGGGGGGGAATCATTTCCGGTATTGGATACAGGACGGTCCTCAAGTCAACAGTGGCGCGATA
TTTCTGGCCGCATCATATGAAAAACCAATTGCTCAACAACATGACATCATTCCTAATGGATACAATTTGGGCCGG
GATTGGCTAGTGGGCAATATCACCCAGTCGTCAATACCTACCCTCAATCTCACAAACGGCACAACATATTCCGGG
TCTACCTCATCCGAAGGGTATACATATAAAACCGACATCTCATACCTTTCCGGTTACCTCGAAGACACGAATTAT
GGTATCAACCATAATATCAGTGTTGGAGTTGACGGAATCAACTCAGTGGATGGATTAGTTGCAGTGTTCGATGTT
GATATAACTCAAGTTCCACCCAACACATCAGCTGCGTGGCGTCCGTCACTAGTTTCGCTATGGCATCTGTCATGT
TACAGTTTTCTGATATCCTTCTTTTCATTTGAACTGTTATCGTAG
Transcript >AgabiH97|104670
ATGCGCTCAAATGCTTTTCTACTGCCATCTGTTGTGCTAATAGCCTCTACACCCTCGTTATGTGATTTTCCAGCT
TGCCGGAGTTGTGGCTCAGAGGAGACGCTTGTTGCTTGGGTTAAACGCTCAGAGCGCAACGTGCCACCCTTAGGA
TATGGGATTCCGACATCTAATGGAGGGAGTATGCTGACGAAAATTCCAGTGACTTATCCAATGGGGCAAGGGGAG
CCTCTAAACATCATCATCAGTGGTAACTCGGACTCCCGTGTGCTAGTCGACTCTCCGAGTGACGGTGGACTTCAG
AATTATTTTCAGTCACTAGGCTTTTCTGGTGAATGCCTCGGTCAACGTGAAAGTGTGCACCAAGCTGCTAACCTC
GGAGATGGGCATGACTTCAAGAATGAAACTGCCGTTATCAGGTGGAATTACGGTGATCCAGAGTTAGGCGCGTGT
AAGGAGACCATTCAGGGGGGGAATCATTTCCGGTATTGGATACAGGACGGTCCTCAAGTCAACAGTGGCGCGATA
TTTCTGGCCGCATCATATGAAAAACCAATTGCTCAACAACATGACATCATTCCTAATGGATACAATTTGGGCCGG
GATTGGCTAGTGGGCAATATCACCCAGTCGTCAATACCTACCCTCAATCTCACAAACGGCACAACATATTCCGGG
TCTACCTCATCCGAAGGGTATACATATAAAACCGACATCTCATACCTTTCCGGTTACCTCGAAGACACGAATTAT
GGTATCAACCATAATATCAGTGTTGGAGTTGACGGAATCAACTCAGTGGATGGATTAGTTGCAGTGTTCGATGTT
GATATAACTCAAGTTCCACCCAACACATCAGCTGCGTGGCGTCCGTCACTAGTTTCGCTATGGCATCTGTCATGT
TACAGTTTTCTGATATCCTTCTTTTCATTTGAACTGTTATCGTAG
Gene >AgabiH97|104670
ATGCGCTCAAATGCTTTTCTACTGCCATCTGTTGTGCTAATAGCCTCTACACCCTCGTTATGTGATTTTCCAGCT
TGCCGGAGTTGTGGCTCAGAGGAGACGCTTGTTGCTTGGGTTAAACGCTCAGAGCGCAACGTGCCACCCTTAGGA
TATGGGATTCCGACATCTAATGGAGGGAGTATGCTGACGGTACGTTGCTTGAACCCTGACAAGCGGGAACAGTAC
ATTTATGCTACAAGATGCTTAGAAAATTCCAGTGACTTATCCAATGGGGCAAGGGGAGCCTCTAAACATCATCAT
CAGTGGTAACTCGGACTCCCGTGTGCTAGTCGACTCTCCGAGTGACGGTGGACTTCAGAATTATTTTCAGTGCGC
GCTTCTATCTATCATGTGTATCAATGGATGTCACAACTTATTCATCTCTTTCATCTTCAGGTCACTAGGCTTTTC
TGGTGAATGCCTCGGTCAACGTGAAAGTGTGCACCAAGCTGCTAACCTCGGAGATGGGCATGACTTCAGTACGTG
TGTTCTCAATACCGTTGAGATTCTTTTTGGGTCTAACGCGATTGACAAGAGAATGAAACTGCCGTTATCAGGTGG
AATTACGGTGATCCAGAGTTAGGCGCGTGTAAGGAGACCATTCAGGGGGGGAATCATTTCCGGTATTGGATACAG
GACGGTCCTCAAGTCAACAGGTATGTCTACCCCATATGAACTATTAAGCAAGAGAAGCTCACGTCAAAGCGGACG
GTAATAGTGGCGCGATATTTCTGGCCGCATCATATGAAAAACCAATTGCTCGTAAGTGCATACTCATTTCACTCA
CTACCTGATACCGGATGTGCTTATCCTGACTCTGTGATTGACAATAGAACAACATGACATCATTCCTAATGGATA
CAATTTGGGCCGGTAAGTTATAACTTCTATCAACCTTTTTTCTGATGATTCTGATGATGCGACAATCACAGGGAT
TGGCTAGTGGGCAATATCACCCAGTCGTCAATACCTACCCTCAATCTCACAAACGGCACAACATATTCCGGGTCT
ACCTCATCCGAAGGGTATACATATAAAACCGACATCTCATACCTTTCCGGTTACCTCGAAGACACGAATTATGGT
ATCAACCATAATATCAGTGTTGGAGTTGACGGAATCAACTCAGTGGATGGATTAGTTGCAGTGTTCGATGTTGAT
ATAACTCAAGTTCCACCCAACACATCGTATGTTCATTTTCGTTCTTTCTTCTCTTTTTCACTGTGAGACTAACTC
TGGCTCATTTGTTTGTCTTCAGAGCTGCGTGGCGTCCGTCACTAGTTTCGCTATGGCATCTGTCATGTTACAGTT
TTCTGATATCCTTCTTTTCATTTGAACTGTTATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail