Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104610
Gene name
Locationscaffold_7:1882619..1884839
Strand+
Gene length (bp)2220
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 7.9E-53 71 513

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 44 542 5.0E-118
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 58 482 9.0E-32
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 68 513 3.0E-31
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 47 481 9.0E-29
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 61 542 9.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 44 542 5.0E-118
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 58 482 9.0E-32
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 68 513 3.0E-31
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 47 481 9.0E-29
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 61 542 9.0E-27
sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 63 543 7.0E-24
sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=1 SV=2 63 543 3.0E-20
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 62 545 1.0E-18
sp|P90893|YM9I_CAEEL Putative serine protease F56F10.1 OS=Caenorhabditis elegans GN=F56F10.1 PE=1 SV=2 69 263 3.0E-18
sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 64 263 7.0E-18
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 63 551 5.0E-17
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 53 261 2.0E-15
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 53 261 3.0E-15
sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 50 544 3.0E-14
sp|P34610|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2 68 224 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104610
MTRFLLPLLLLGFTSFTGVNSFSPVIGPQGVNFWNLDKQEARERGASSRRDLPLEISARAFEEFEPQWFEQPLDH
FDESNPHTFKQRYWVSKRHYKARQGAPVFVLDGGETSGANRLPFLDTGIVDILARATEGLGVILEHRYYGESIAV
ENLTTDALRWLNNEQAAADSANFMAKVKFNGIEEDLTAPSTPWIYYGGSYAGARSAHMKILYPDLVYGAIASSAV
THAAVENWQYMEIIRKAADPKCSHHLENSIKIIDSILLGHSKFFKSHLKGLFGLANLTHDDDFASTISSPLGSWQ
SKNWDPEESSVRFDQFCEALNAPVHGHGISAKATDLPFGDPARMVEVADGLTLDLSILNYGAYIKNNTASRCRTT
LDDCFGTYDDSKYQQTGLDEDWRLWMFQVCTQWGYFTTTPPDPKQPRILSRLITLPHESKICQQAYLPGDFFQVP
PLPNVTAVNMLGDFDIVADRLMFVDGEVDPWRPDTPHSDGAKPRDDTILRPFKLIPGAVHHWDENGLADVTQEPV
VIQDIHAEEVAIIEQWLADWKPPTKKD*
Coding >AgabiH97|104610
ATGACCCGCTTTCTCCTTCCACTACTCCTGTTGGGCTTTACGTCCTTCACCGGTGTCAACAGCTTCAGTCCAGTA
ATAGGACCTCAAGGCGTCAACTTCTGGAATCTCGACAAACAGGAAGCTCGTGAACGGGGTGCTTCATCGCGCCGC
GATCTTCCTCTTGAAATTTCAGCTAGGGCGTTTGAAGAATTTGAACCACAGTGGTTTGAACAACCTTTGGATCAT
TTTGATGAATCCAATCCGCATACGTTCAAGCAGCGGTACTGGGTGAGTAAGAGACACTACAAGGCGAGGCAAGGC
GCACCCGTTTTTGTACTGGATGGTGGAGAGACTAGTGGAGCGAACAGGCTGCCCTTCCTCGACACCGGCATCGTC
GATATCCTTGCTCGCGCAACTGAAGGTCTTGGTGTAATTCTGGAGCACCGTTACTATGGTGAATCAATCGCCGTC
GAGAACTTGACTACCGATGCCCTCCGCTGGCTTAACAACGAACAGGCTGCTGCAGACAGCGCAAACTTTATGGCC
AAAGTCAAGTTTAATGGAATCGAAGAGGATTTGACTGCTCCTAGTACTCCGTGGATCTATTATGGTGGCTCGTAT
GCTGGTGCGCGCTCAGCTCACATGAAGATTCTCTATCCCGATCTCGTCTACGGTGCCATCGCATCCAGTGCTGTC
ACTCATGCTGCTGTCGAGAATTGGCAATACATGGAGATCATTCGGAAAGCCGCAGACCCCAAATGTTCTCACCAC
CTCGAGAATTCCATCAAAATCATCGACTCTATCCTCCTCGGTCACAGCAAGTTTTTCAAGTCGCATTTGAAAGGC
TTATTCGGTTTAGCCAACTTGACACATGATGACGATTTCGCTTCCACAATCTCCAGTCCTCTTGGTTCTTGGCAA
TCGAAGAATTGGGATCCTGAAGAGAGTAGTGTGAGATTCGACCAATTCTGTGAAGCTCTGAATGCACCGGTACAT
GGACATGGAATCTCTGCGAAGGCTACGGATTTACCTTTTGGTGATCCTGCGCGTATGGTTGAGGTTGCTGATGGT
CTCACTTTGGATTTATCGATCTTGAATTATGGAGCTTATATCAAGAATAATACTGCCTCAAGGTGTAGAACTACT
CTCGATGACTGTTTTGGAACGTATGATGATAGCAAATACCAACAGACTGGTCTGGATGAAGATTGGAGACTCTGG
ATGTTCCAAGTTTGCACTCAATGGGGTTACTTCACAACTACCCCTCCCGATCCCAAACAACCTCGTATCCTCTCC
CGCCTCATCACCCTCCCCCACGAATCCAAAATCTGCCAGCAAGCTTATTTACCTGGAGATTTCTTCCAAGTCCCA
CCTCTACCCAATGTTACTGCCGTGAATATGTTGGGAGATTTCGATATTGTAGCGGATAGATTGATGTTTGTGGAT
GGGGAAGTTGATCCTTGGAGACCTGATACCCCTCATAGCGATGGTGCTAAACCAAGAGACGATACCATTTTGAGG
CCATTCAAGTTAATTCCCGGCGCGGTACATCATTGGGATGAAAATGGATTGGCTGATGTGACTCAAGAACCGGTT
GTAATTCAAGATATACATGCAGAGGAAGTGGCAATTATAGAACAATGGTTGGCGGATTGGAAACCTCCGACAAAG
AAAGACTGA
Transcript >AgabiH97|104610
ATGACCCGCTTTCTCCTTCCACTACTCCTGTTGGGCTTTACGTCCTTCACCGGTGTCAACAGCTTCAGTCCAGTA
ATAGGACCTCAAGGCGTCAACTTCTGGAATCTCGACAAACAGGAAGCTCGTGAACGGGGTGCTTCATCGCGCCGC
GATCTTCCTCTTGAAATTTCAGCTAGGGCGTTTGAAGAATTTGAACCACAGTGGTTTGAACAACCTTTGGATCAT
TTTGATGAATCCAATCCGCATACGTTCAAGCAGCGGTACTGGGTGAGTAAGAGACACTACAAGGCGAGGCAAGGC
GCACCCGTTTTTGTACTGGATGGTGGAGAGACTAGTGGAGCGAACAGGCTGCCCTTCCTCGACACCGGCATCGTC
GATATCCTTGCTCGCGCAACTGAAGGTCTTGGTGTAATTCTGGAGCACCGTTACTATGGTGAATCAATCGCCGTC
GAGAACTTGACTACCGATGCCCTCCGCTGGCTTAACAACGAACAGGCTGCTGCAGACAGCGCAAACTTTATGGCC
AAAGTCAAGTTTAATGGAATCGAAGAGGATTTGACTGCTCCTAGTACTCCGTGGATCTATTATGGTGGCTCGTAT
GCTGGTGCGCGCTCAGCTCACATGAAGATTCTCTATCCCGATCTCGTCTACGGTGCCATCGCATCCAGTGCTGTC
ACTCATGCTGCTGTCGAGAATTGGCAATACATGGAGATCATTCGGAAAGCCGCAGACCCCAAATGTTCTCACCAC
CTCGAGAATTCCATCAAAATCATCGACTCTATCCTCCTCGGTCACAGCAAGTTTTTCAAGTCGCATTTGAAAGGC
TTATTCGGTTTAGCCAACTTGACACATGATGACGATTTCGCTTCCACAATCTCCAGTCCTCTTGGTTCTTGGCAA
TCGAAGAATTGGGATCCTGAAGAGAGTAGTGTGAGATTCGACCAATTCTGTGAAGCTCTGAATGCACCGGTACAT
GGACATGGAATCTCTGCGAAGGCTACGGATTTACCTTTTGGTGATCCTGCGCGTATGGTTGAGGTTGCTGATGGT
CTCACTTTGGATTTATCGATCTTGAATTATGGAGCTTATATCAAGAATAATACTGCCTCAAGGTGTAGAACTACT
CTCGATGACTGTTTTGGAACGTATGATGATAGCAAATACCAACAGACTGGTCTGGATGAAGATTGGAGACTCTGG
ATGTTCCAAGTTTGCACTCAATGGGGTTACTTCACAACTACCCCTCCCGATCCCAAACAACCTCGTATCCTCTCC
CGCCTCATCACCCTCCCCCACGAATCCAAAATCTGCCAGCAAGCTTATTTACCTGGAGATTTCTTCCAAGTCCCA
CCTCTACCCAATGTTACTGCCGTGAATATGTTGGGAGATTTCGATATTGTAGCGGATAGATTGATGTTTGTGGAT
GGGGAAGTTGATCCTTGGAGACCTGATACCCCTCATAGCGATGGTGCTAAACCAAGAGACGATACCATTTTGAGG
CCATTCAAGTTAATTCCCGGCGCGGTACATCATTGGGATGAAAATGGATTGGCTGATGTGACTCAAGAACCGGTT
GTAATTCAAGATATACATGCAGAGGAAGTGGCAATTATAGAACAATGGTTGGCGGATTGGAAACCTCCGACAAAG
AAAGACTGA
Gene >AgabiH97|104610
ATGACCCGCTTTCTCCTTCCACTACTCCTGTTGGGCTTTACGTCCTTCACCGGTGTCAACAGCTTCAGTCCAGTA
ATAGGACCTCAAGGCGTCAACTTCTGGAATCTCGACAAACAGGAAGCTCGTGAACGGGGTGCTTCATCGCGCCGC
GATCTTCCTCTTGAAAGTAAAGCCCTTACCGTCCAAAGTGGCAATTGGCTGCCCGATAACGAAGCCATAGTTTCA
GCTAGGGCGTTTGAAGAATTTGAACCACAGTGGTTTGAACAACCTTTGGATCATTTTGATGAATCCAATCCGCAT
ACGTTCAAGCAGCGGTACTGGGTGAGTAAGAGACACTACAAGGCGAGGCAAGGCGCACCCGTTTTTGTACTGGAT
GGTGGAGAGACTAGTGGAGCGGTACGCTGGTTTCATGATTCAGAGCGCAATATCGTAAATCGAGCGAAATATATA
GAACAGGCTGCCCTTCCTCGACACCGGCATCGTCGATATCCTTGCTCGCGCAACTGAAGGTCTTGGTGTAATTCT
GGAGCACCGTTACTATGGTATGGTTTCCCTTGCTCTGCGGAAGCATGATTGACCCATATCTGGTTAGGTGAATCA
ATCGCCGTCGAGAACTTGACTACCGATGCCCTCCGGTACGCTTCTCGACTCACTCATACTCAAACCCCCGAGTCT
AATGAATAGGACTTTAGCTGGCTTAACAACGAACAGGCTGCTGCAGACAGCGCAAACTTTATGGCCAAAGTCAAG
TTTAATGGAATCGAAGAGGATTTGACTGCTCCTAGTACTCCGTGGATCTATTATGGTGTACGTTCCTCGCCTGAC
CCACCTTATTGTACACTCATTTTTTCGTAGGGCTCGTATGCTGGTGCGCGCTCAGCTCACATGAAGATTCTCTAT
CCCGATCTCGTCTACGGTGCCATCGCATCCAGTGGTACGTTCACATTCGTTTCATCAACTTTTCCCCCTTCTAAA
AACTTCAATTCATCAAAGCTGTCACTCATGCTGCTGTCGAGAATTGGCAATACATGGAGATCATTCGGAAAGCCG
CAGACCCCAAATGTTCTCACCACCTCGAGAATTCCATCAAAATCATCGACTCTATCCTCCTCGGTCACAGCAAGT
TTTTCAAGTCGCATTTGAAAGGCTTATTCGGTTTAGCCAACTTGACACATGATGACGATTTCGCTTCCACAATCT
CCGTATGTTCATCCAGTCAACCGTCAAAATCTTTATACCATGAAAGTAATTTCTGACTTGTTCTGTAGAGTCCTC
TTGGTTCTTGGCAATCGAAGAATTGGGATCCTGAAGAGAGTAGTGTGAGATTCGACCAATTCTGTGAAGCTCTGA
ATGCACCGGTACATGGACATGGAATCTCTGCGAAGGCTACGGATTTACCTTTTGGTGATCCTGCGCGTATGGTTG
AGGTTGCTGATGGTCTCACTTTGGATTTATCGATCTTGAATTATGGAGCTTATATCAAGAATAATACTGCCTCAA
GGTGTAGAACTACTCTCGATGACGTGAGTAGTTTACTATTGGAGGTTTTTCTGATGGAGGATGCTAAAACCCGAT
TTCATGATAGTGTTTTGGAACGTATGATGATAGCAAATACCAACAGACTGGTCTGGATGAAGATTGGAGACTCTG
GATGTTCCAAGTTTGCACTCAATGGGGTTACTTCACAGTACGTGTTTCCATCCATCAATACAAAAAAAAACCAAA
CTCATGATTTTCTACTCCTTACATAGACTACCCCTCCCGATCCCAAACAACCTCGTATCCTCTCCCGCCTCATCA
CCCTCCCCCACGAATCCAAAATCTGCCAGCAAGCTTATTTACCTGGAGATTTCTTCCAAGTCCCACCTCTACCCA
ATGTTACTGCCGTGAATATGTTGGGAGATTTCGATATTGTAGCGGATAGATTGATGTTTGTGGATGGGGAAGTTG
ATCCTTGGAGACCTGATACCCCTCATAGCGATGGTGCTAAACCAAGAGACGATACCATTTTGAGGCCATTCAAGT
TAATTCCCGGTACGTCGATAGGGATCTACTCAACTTGTTCTAACGAATTTATTAGGCGCGGTACATCATTGGGAT
GAAAATGGATTGGCTGATGTGACTCAAGAACCGGTTGTAATTCAAGATATACATGCAGAGGAAGTGGCAATTATA
GAACAATGGTTGGCGGATTGGAAACCTCCGACAAAGAAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail