Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104530
Gene name
Locationscaffold_7:1860755..1863486
Strand+
Gene length (bp)2731
Transcript length (bp)2271
Coding sequence length (bp)2271
Protein length (aa) 757

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05964 FYRN F/Y-rich N-terminus 5.4E-18 453 502
PF05965 FYRC F/Y rich C-terminus 7.2E-16 508 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3UB74|TBRG1_MOUSE Transforming growth factor beta regulator 1 OS=Mus musculus GN=Tbrg1 PE=1 SV=2 438 615 1.0E-26
sp|Q5PQK8|TBRG1_RAT Transforming growth factor beta regulator 1 OS=Rattus norvegicus GN=Tbrg1 PE=2 SV=2 438 615 7.0E-26
sp|Q3YBR2|TBRG1_HUMAN Transforming growth factor beta regulator 1 OS=Homo sapiens GN=TBRG1 PE=1 SV=1 438 585 2.0E-23
sp|Q66IH2|TBRG1_XENTR Transforming growth factor beta regulator 1 OS=Xenopus tropicalis GN=tbrg1 PE=2 SV=1 418 585 5.0E-22
sp|Q8IRW8|TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster GN=trr PE=1 SV=2 450 583 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3UB74|TBRG1_MOUSE Transforming growth factor beta regulator 1 OS=Mus musculus GN=Tbrg1 PE=1 SV=2 438 615 1.0E-26
sp|Q5PQK8|TBRG1_RAT Transforming growth factor beta regulator 1 OS=Rattus norvegicus GN=Tbrg1 PE=2 SV=2 438 615 7.0E-26
sp|Q3YBR2|TBRG1_HUMAN Transforming growth factor beta regulator 1 OS=Homo sapiens GN=TBRG1 PE=1 SV=1 438 585 2.0E-23
sp|Q66IH2|TBRG1_XENTR Transforming growth factor beta regulator 1 OS=Xenopus tropicalis GN=tbrg1 PE=2 SV=1 418 585 5.0E-22
sp|Q8IRW8|TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster GN=trr PE=1 SV=2 450 583 2.0E-15
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 442 583 3.0E-08
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 442 583 3.0E-08
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 450 583 8.0E-08
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 450 583 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104530
MTLAAANDPRTISSLSSSSSAPRPQNGAGKSTPQDKTEMELQLSEGVLEKYTPSNGSQPHLEPTRDVLVDIDPSQ
PPGTPSASGNHLELNHVSTSTEDFTTSGSDKVDPVAEVVSLLSAPSESFGRPDPPQEKLESFPGDFSTHDTPQSE
VEERSTSTARLRSPSLQSQDFTPNKNGTRSKADASGVENVVMVARDRNSGSDDQASNVSERPPKSTRSKQKRPPD
TIFQGSAKRARMTTDTFSSPVVTLMSDDRSCRTNDEDLQMNHSPSVPTSTVSSNTEKDQLKDAVDAAPILIWLRH
LTLLPKSSRIQIHPPNLHLRPTAPSTSSLANNPYFALSTAFLKGPPNPASNGYNPYSLYYGPGAPISPHTPTYPY
PYLYQVHSPISAAMYSTSPSFIPSPTQKSPSPHTPTGAEPQRQKPKRLKAHTVTSGNHNIPIVPRDKKGKPMLPL
NVGIMTVISLGEVCMREHFHTERYIFPVGYEVTRRYLSTIDPTAEVVYHCTILDGGDGPKFQIVPSDAPGREVIA
GTATGAWSSIVKQANAIRSRQHSNSVSGPDFFGLGQNTIKHLIQELPNADRLKDYVWQNFIEGGPLGGRHAAVTP
ALPEDYDSTLPIGALYPAERERLKREVATSPRGLNHYPQHIIAQAEAQVQRKEPSGGQISGQQPSAGHPLVPSEV
TLPLLNGHAMPHSSPGHLLGPGAVISSTQPSASAPPNTQGPSSVPATIASIMSAYPAPVATPPVATTSSTPPSGS
ASSLPS*
Coding >AgabiH97|104530
ATGACCCTCGCTGCAGCCAACGACCCCCGCACCATTTCTTCCCTCTCCAGCTCATCCTCTGCCCCTCGCCCCCAG
AATGGGGCTGGCAAATCCACGCCCCAAGATAAAACCGAGATGGAGCTTCAACTATCCGAGGGAGTGCTCGAGAAA
TATACTCCATCAAATGGTTCACAACCGCACCTTGAACCTACCCGTGATGTACTAGTAGACATCGACCCTTCCCAG
CCCCCCGGGACTCCTTCAGCCTCCGGCAATCATCTCGAATTAAATCATGTTTCGACATCCACGGAAGACTTTACA
ACGAGTGGCTCCGATAAAGTAGACCCTGTAGCAGAGGTTGTTTCTCTGCTCTCAGCACCATCTGAGTCTTTTGGA
AGACCAGATCCTCCTCAAGAAAAACTGGAGTCATTTCCTGGAGACTTCTCCACACACGATACGCCCCAAAGCGAG
GTTGAAGAACGAAGTACCTCAACCGCAAGGCTGCGGTCCCCCTCTCTTCAATCCCAGGATTTTACACCAAACAAA
AACGGGACGCGTTCAAAAGCAGATGCCTCCGGTGTAGAGAATGTTGTCATGGTTGCTCGTGATCGAAACTCAGGC
TCCGATGATCAGGCATCTAATGTTTCTGAACGCCCTCCTAAATCTACGAGGTCAAAGCAAAAACGTCCTCCTGAT
ACGATATTTCAAGGCTCTGCAAAACGGGCGCGGATGACTACTGATACTTTCTCTAGTCCAGTAGTCACTCTCATG
TCTGACGATCGTAGTTGTCGCACGAATGACGAGGACCTCCAAATGAATCATTCACCCTCTGTGCCAACCTCAACC
GTGAGCTCAAATACAGAAAAAGACCAGCTGAAAGATGCGGTTGATGCTGCTCCGATTCTAATCTGGCTCCGTCAC
TTGACTCTTCTCCCAAAGTCGTCCAGAATTCAAATACATCCCCCCAACCTCCATCTCCGGCCAACGGCCCCAAGT
ACCTCTAGTTTAGCTAACAATCCTTATTTTGCCCTCAGCACTGCCTTTTTGAAGGGACCGCCAAATCCAGCTTCA
AACGGTTACAATCCGTACAGTTTATATTATGGTCCCGGAGCTCCTATCTCGCCCCATACACCGACGTACCCATAT
CCTTATCTATATCAGGTTCACAGTCCTATATCTGCGGCTATGTACTCAACAAGCCCTAGCTTCATACCGTCACCT
ACCCAGAAATCGCCGTCTCCCCACACTCCCACCGGTGCCGAACCACAGCGACAAAAGCCAAAGCGGTTAAAGGCA
CACACGGTGACCAGTGGGAATCACAATATACCCATCGTTCCGCGAGATAAAAAGGGCAAACCGATGCTTCCTCTG
AATGTGGGTATCATGACCGTCATCAGTTTGGGTGAGGTATGTATGCGCGAGCATTTTCATACCGAACGATATATA
TTTCCTGTTGGGTATGAGGTTACTAGGCGGTATCTATCGACAATAGATCCGACCGCAGAAGTTGTCTATCATTGT
ACAATCCTAGATGGAGGTGATGGACCCAAATTTCAAATAGTGCCTTCGGATGCCCCGGGAAGGGAGGTCATAGCG
GGTACTGCAACTGGTGCTTGGTCAAGCATCGTGAAGCAGGCCAATGCTATCCGGAGTCGCCAACATTCCAACTCG
GTTTCAGGTCCTGATTTCTTCGGGCTAGGGCAGAATACGATCAAGCATTTAATTCAGGAGCTACCGAATGCCGAC
CGGTTGAAGGATTACGTTTGGCAAAATTTCATCGAGGGGGGCCCTCTAGGTGGTCGACACGCAGCCGTCACACCT
GCACTTCCCGAAGATTACGACTCAACGTTGCCTATCGGCGCATTATATCCTGCAGAACGTGAACGATTAAAGCGT
GAGGTTGCCACGAGTCCTCGTGGTTTAAACCATTACCCGCAACATATCATAGCTCAGGCTGAAGCACAAGTGCAA
CGGAAGGAGCCCAGTGGTGGTCAAATATCTGGTCAACAGCCTAGCGCCGGTCATCCACTTGTCCCCTCCGAAGTA
ACTTTACCTCTACTCAACGGCCACGCCATGCCACATAGTTCTCCAGGCCATCTCCTTGGTCCTGGTGCTGTCATT
TCCTCCACTCAGCCCTCTGCATCCGCTCCACCTAACACTCAGGGACCTTCATCCGTTCCAGCAACGATTGCGAGT
ATAATGAGTGCTTATCCTGCCCCTGTTGCCACACCCCCTGTAGCGACGACTTCTTCCACTCCCCCATCTGGTTCT
GCTTCATCCTTGCCATCATAA
Transcript >AgabiH97|104530
ATGACCCTCGCTGCAGCCAACGACCCCCGCACCATTTCTTCCCTCTCCAGCTCATCCTCTGCCCCTCGCCCCCAG
AATGGGGCTGGCAAATCCACGCCCCAAGATAAAACCGAGATGGAGCTTCAACTATCCGAGGGAGTGCTCGAGAAA
TATACTCCATCAAATGGTTCACAACCGCACCTTGAACCTACCCGTGATGTACTAGTAGACATCGACCCTTCCCAG
CCCCCCGGGACTCCTTCAGCCTCCGGCAATCATCTCGAATTAAATCATGTTTCGACATCCACGGAAGACTTTACA
ACGAGTGGCTCCGATAAAGTAGACCCTGTAGCAGAGGTTGTTTCTCTGCTCTCAGCACCATCTGAGTCTTTTGGA
AGACCAGATCCTCCTCAAGAAAAACTGGAGTCATTTCCTGGAGACTTCTCCACACACGATACGCCCCAAAGCGAG
GTTGAAGAACGAAGTACCTCAACCGCAAGGCTGCGGTCCCCCTCTCTTCAATCCCAGGATTTTACACCAAACAAA
AACGGGACGCGTTCAAAAGCAGATGCCTCCGGTGTAGAGAATGTTGTCATGGTTGCTCGTGATCGAAACTCAGGC
TCCGATGATCAGGCATCTAATGTTTCTGAACGCCCTCCTAAATCTACGAGGTCAAAGCAAAAACGTCCTCCTGAT
ACGATATTTCAAGGCTCTGCAAAACGGGCGCGGATGACTACTGATACTTTCTCTAGTCCAGTAGTCACTCTCATG
TCTGACGATCGTAGTTGTCGCACGAATGACGAGGACCTCCAAATGAATCATTCACCCTCTGTGCCAACCTCAACC
GTGAGCTCAAATACAGAAAAAGACCAGCTGAAAGATGCGGTTGATGCTGCTCCGATTCTAATCTGGCTCCGTCAC
TTGACTCTTCTCCCAAAGTCGTCCAGAATTCAAATACATCCCCCCAACCTCCATCTCCGGCCAACGGCCCCAAGT
ACCTCTAGTTTAGCTAACAATCCTTATTTTGCCCTCAGCACTGCCTTTTTGAAGGGACCGCCAAATCCAGCTTCA
AACGGTTACAATCCGTACAGTTTATATTATGGTCCCGGAGCTCCTATCTCGCCCCATACACCGACGTACCCATAT
CCTTATCTATATCAGGTTCACAGTCCTATATCTGCGGCTATGTACTCAACAAGCCCTAGCTTCATACCGTCACCT
ACCCAGAAATCGCCGTCTCCCCACACTCCCACCGGTGCCGAACCACAGCGACAAAAGCCAAAGCGGTTAAAGGCA
CACACGGTGACCAGTGGGAATCACAATATACCCATCGTTCCGCGAGATAAAAAGGGCAAACCGATGCTTCCTCTG
AATGTGGGTATCATGACCGTCATCAGTTTGGGTGAGGTATGTATGCGCGAGCATTTTCATACCGAACGATATATA
TTTCCTGTTGGGTATGAGGTTACTAGGCGGTATCTATCGACAATAGATCCGACCGCAGAAGTTGTCTATCATTGT
ACAATCCTAGATGGAGGTGATGGACCCAAATTTCAAATAGTGCCTTCGGATGCCCCGGGAAGGGAGGTCATAGCG
GGTACTGCAACTGGTGCTTGGTCAAGCATCGTGAAGCAGGCCAATGCTATCCGGAGTCGCCAACATTCCAACTCG
GTTTCAGGTCCTGATTTCTTCGGGCTAGGGCAGAATACGATCAAGCATTTAATTCAGGAGCTACCGAATGCCGAC
CGGTTGAAGGATTACGTTTGGCAAAATTTCATCGAGGGGGGCCCTCTAGGTGGTCGACACGCAGCCGTCACACCT
GCACTTCCCGAAGATTACGACTCAACGTTGCCTATCGGCGCATTATATCCTGCAGAACGTGAACGATTAAAGCGT
GAGGTTGCCACGAGTCCTCGTGGTTTAAACCATTACCCGCAACATATCATAGCTCAGGCTGAAGCACAAGTGCAA
CGGAAGGAGCCCAGTGGTGGTCAAATATCTGGTCAACAGCCTAGCGCCGGTCATCCACTTGTCCCCTCCGAAGTA
ACTTTACCTCTACTCAACGGCCACGCCATGCCACATAGTTCTCCAGGCCATCTCCTTGGTCCTGGTGCTGTCATT
TCCTCCACTCAGCCCTCTGCATCCGCTCCACCTAACACTCAGGGACCTTCATCCGTTCCAGCAACGATTGCGAGT
ATAATGAGTGCTTATCCTGCCCCTGTTGCCACACCCCCTGTAGCGACGACTTCTTCCACTCCCCCATCTGGTTCT
GCTTCATCCTTGCCATCATAA
Gene >AgabiH97|104530
ATGACCCTCGCTGCAGCCAACGACCCCCGCACCATTTCTTCCCTCTCCAGCTCATCCTCTGCCCCTCGCCCCCAG
AATGGGGCTGGCAAATCCACGCCCCAAGATAAAACCGAGATGGAGCTTCAACTATCCGAGGGAGTGCTCGAGGTG
GGTGTGCGAATGTCCATCTTCATATTTTGCCGCGGTGCCCAGTCTTAAATGCGTACATCAGAAATATACTCCATC
AAATGGTTCACAACCGCACCTTGAACCTACCCGTGATGTACTAGTAGACATCGAGTGCGCCGGCTTTCTCGTCTT
TATCTGATTCAGGTTCTGACCTTTTTGGGGTCAGCCCTTCCCAGCCCCCCGGGACTCCTTCAGCCTCCGGCAATC
ATCTCGAATTAAATCATGTTTCGACATCCACGGAAGACTTTACAACGAGTGGCTCCGATAAAGTAGACCCTGTAG
CAGAGGTTGTTTCTCTGCGTGAGTTATATCGCAAATATGTCATGAACGCGGACTGACATCTTCTGTTATACTCTA
GTCTCAGCACCATCTGAGTCTTTTGGAAGACCAGATCCTCCTCAAGAAAAACTGGAGTCATTTCCTGGAGACTTC
TCCACACACGATACGCCCCAAAGCGAGGTTGAAGAACGAAGTACCTCAACCGCAAGGCTGCGGTCCCCCTCTCTT
CAATCCCAGGATTTTACACCAAACAAAAACGGGACGCGTTCAAAAGCAGATGCCTCCGGTGTAGAGAATGTTGTC
ATGGTTGCTCGTGATCGAAACTCAGGCTCCGATGATCAGGCATCTAATGTTTCTGAACGCCCTCCTAAATCTACG
AGGTCAAAGCAAAAACGTCCTCCTGATACGATATTTCAAGGCTCTGCAAAACGGGCGCGGATGACTACTGATACT
TTCTCTAGTCCAGTAGTCACTCTCATGTCTGACGATCGTAGTTGTCGCACGAATGACGAGGGTAAGTAAGACCGT
GTTTCTCCTTATTTCCGCAGACGTTACCCAATCCTGAATTACGGCCCTGTTTACATATTAGACCTCCAAATGAAT
CATTCACCCTCTGTGCCAACCTCAACCGTGAGCTCAAATACAGAAAAAGACCAGCTGAAAGATGCGGTTGATGCT
GCTCCGGTTTGCGATTCCTCAATTGCAAATTTTCAGACGACATCCGAAATTAATTCGAATTCAGATTCTAATCTG
GCTCCGTCACTTGACTCTTCTCCCAAAGTCGTCCAGAATTCAAATACATCCCCCCAACCTCCATCTCCGGGTTCT
TCAAAAATCCCTTCTCAAGACAAATCACCGCAGACCCAGCCAACGGCCCCAAGTACCTCTAGTTTAGCTAACAAT
CCTTATTTTGCCCTCAGCACTGCCTTTTTGAAGGGACCGCCAAATCCAGCTTCAAACGGTTACAATCCGTACAGT
TTATATTATGGTCCCGGAGCTCCTATCTCGCCCCATACACCGACGTACCCATATCCTTATCTATATCAGGTTCAC
AGTCCTATATCTGCGGCTATGTACTCAACAAGCCCTAGCTTCATACCGTCACCTACCCAGAAATCGCCGTCTCCC
CACACTCCCACCGGTGCCGAACCACAGCGACAAAAGCCAAAGCGGTTAAAGGCACACACGGTGACCAGTGGGAAT
CACAATATACCCATCGTTCCGCGAGATAAAAAGGGCAAACCGATGCTTCCTCTGAATGTGGGTATCATGACCGTC
ATCAGTTTGGGTGAGGTATGTATGCGCGAGCATTTTCATACCGAACGATATATATTTCCTGTTGGGTATGAGGTT
ACTAGGTAATTTTACCTGTCACGACTTCAAACAACGGTTCTAATTTTACTTTGACCAGGCGGTATCTATCGACAA
TAGATCCGACCGCAGAAGTTGTCTATCATTGTACAATCCTAGATGGAGGTGATGGACCCAAATTTCAAATAGTGC
CTTCGGATGCCCCGGGAAGGGAGGTCATAGCGGGTACTGCAACTGGTGCTTGGTCAAGCATCGTGAAGCAGGCCA
ATGCTATCCGGAGTCGCCAACATTCCAACTCGGTTTCAGGTCCTGATTTCTTCGGGCTAGGGCAGAATACGATCA
AGCATTTAATTCAGGAGCTACCGAATGCCGACCGGTTGAAGGATTACGTTTGGCAAAATTTCATCGAGGGGGGGT
ATGTCCTTTCTTCTTTTACGTGAGGTTCTCGGCTTCAACACGTTTCTATAGCCCTCTAGGTGGTCGACACGCAGC
CGTCACACCTGCACTTCCCGAAGATTACGACTCAACGTTGCCTATCGGCGCATTATATCCTGCAGAACGTGAACG
ATTAAAGCGTGAGGTTGCCACGAGTCCTCGTGGTTTAAACCATTACCCGCAACATATCATAGCTCAGGCTGAAGC
ACAAGTGCAACGGAAGGAGCCCAGTGGTGGTCAAATATCTGGTCAACAGCCTAGCGCCGGTCATCCACTTGTCCC
CTCCGAAGTAACTTTACCTCTACTCAACGGCCACGCCATGCCACATAGTTCTCCAGGCCATCTCCTTGGTCCTGG
TGCTGTCATTTCCTCCACTCAGCCCTCTGCATCCGCTCCACCTAACACTCAGGGACCTTCATCCGTTCCAGCAAC
GATTGCGAGTATAATGAGTGCTTATCCTGCCCCTGTTGCCACACCCCCTGTAGCGACGACTTCTTCCACTCCCCC
ATCTGGTTCTGCTTCATCCTTGCCATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail