Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104360
Gene name
Locationscaffold_7:1819688..1823584
Strand-
Gene length (bp)3896
Transcript length (bp)3315
Coding sequence length (bp)3315
Protein length (aa) 1105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10405 BHD_3 Rad4 beta-hairpin domain 3 8.0E-28 635 707
PF03835 Rad4 Rad4 transglutaminase-like domain 4.0E-20 356 497
PF10404 BHD_2 Rad4 beta-hairpin domain 2 1.8E-17 559 628
PF10403 BHD_1 Rad4 beta-hairpin domain 1 1.4E-16 504 555
PF01841 Transglut_core Transglutaminase-like superfamily 2.2E-05 200 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 326 750 3.0E-72
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 43 750 2.0E-70
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 360 751 6.0E-55
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 421 749 7.0E-52
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 360 750 3.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 326 750 3.0E-72
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 43 750 2.0E-70
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 360 751 6.0E-55
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 421 749 7.0E-52
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 360 750 3.0E-50
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 357 750 3.0E-46
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 357 750 1.0E-40
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 347 752 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104360
MDDHLLSLGADSDDDNDWEEVEFPELQDRTIEITLNAQPKAGEDKQKRGLSHAERILRIDCHKIHTICLLTNAWV
RNKYLNDELLHARLLSICPLKYQDSFATIHKSRIPDPNQRGRMFENAVRDLASWWSSAFEVVPEGHLRNRTFLDV
EKVLERYHLLSNDDDSVNGEMDVEVLQDVLDEDGEFIRTPKSLMKHALMARGSRDTSAQLFTALCRALGIPARLV
ASLQSVPWQASVGKPKPKYEKKTKGKKKGKATASESTSVASEGGESENEDDIKEMGASTPTRESKGKGKATDFPG
SGQRLDGGSMSAKAKGKQKARPPIKLRKARPKGRTLGSLSPTSDASPLPLDPTTTPPVFWTEVFSKPDGRWLPVD
PIRNIVNKRKVFDPTPSSINTPPNTAVAHFSRFNSPVPNKKPSRTQQNAENRLLYVLAFEEDGFARDVTRRYARD
YSTKVVKAQGGSGAANMGGRRAWWGHVLSIVHRPYRLHRDDIEDEELETAQMLEGMPTTMTGFKDHPVYVLIRHL
KQNETLYPPPPSTPELGKFRGEPVYPRSAVVSLKTAENWMRNEGRTIKTGEQPLKMVKVRAGTVNKLRELEVLKE
AGGSGEGNSGDAMQGLYARLQTELYIPDPVVDGIIPKNNFGNIDLYTPSMLPQGAAHIPYKGVAKVARNLGFDFA
EAVTGFEFKKRRAYPVLEGVVIAKENEDTLLEAFWEFERIAEARAQVKREERVLKQWKRLIQGLRIRQRLQEQYG
TTPGVVGEGGEVDKGQEGKVEISRRDDNHNAKVLLLSSSSSSLSTPKKKEKEKEKNKNSIVDEDEDRDGDLVSVL
KKESTDKNGEEGEDAFSQIEIELEPSEHDHHDFIEADDVVQAFHLPKFQHVPDAPVVSFHHQQHSSKSLERGEEN
LMRAIPDFVTYDLDNEDEQNVEHRHIIPLNLRDASNNNNNNTTENPTSMMIPKTMAQFAEDAAAQQEVDLQVLTE
DITSVTSVNGNEVERLRRGKVRKLSSSAAPTTMNVRTTGQRHRNMLGRTTMGGRKRKQGDEDDFLSDDDNDEDES
KRTTNPTSTSTTTTITRKRRKKDVPVSTRTLRPRRSKSVVVYAENPDDDDDDEG*
Coding >AgabiH97|104360
ATGGACGACCACCTCCTTTCGCTGGGCGCTGACAGTGACGACGATAATGACTGGGAAGAAGTCGAGTTCCCTGAA
CTACAGGACAGGACCATTGAAATTACTCTAAATGCGCAACCCAAGGCCGGCGAGGACAAGCAGAAGAGAGGTCTA
TCCCATGCAGAGCGCATACTTCGAATCGATTGCCACAAGATACATACAATCTGCTTGCTAACAAATGCATGGGTG
CGGAATAAGTATCTAAACGATGAATTACTTCACGCTCGTTTACTGTCAATATGCCCACTCAAATATCAAGATTCT
TTTGCGACAATACATAAATCACGAATCCCGGATCCGAATCAGCGGGGGCGGATGTTCGAAAACGCAGTCCGAGAC
CTCGCCAGTTGGTGGTCGTCAGCTTTCGAAGTAGTTCCAGAGGGGCATCTCCGCAATCGTACTTTCCTCGATGTT
GAAAAAGTCTTAGAACGATACCATCTTCTTTCCAACGACGATGATTCTGTTAATGGTGAAATGGACGTGGAAGTT
CTTCAGGATGTCTTGGACGAGGACGGAGAGTTCATACGGACCCCTAAAAGTCTGATGAAGCATGCTCTTATGGCA
AGAGGCTCAAGAGACACAAGTGCGCAACTTTTCACAGCTTTATGTCGGGCTCTTGGGATACCCGCTCGCCTCGTA
GCGAGTCTTCAGAGCGTGCCTTGGCAAGCAAGTGTCGGAAAACCGAAACCAAAATATGAGAAAAAGACCAAGGGC
AAAAAGAAAGGGAAAGCTACAGCTTCGGAGAGCACTTCTGTGGCCTCGGAGGGTGGAGAATCTGAAAATGAAGAT
GACATAAAAGAAATGGGTGCCTCAACTCCGACGCGGGAGTCAAAAGGAAAGGGCAAGGCTACAGACTTTCCAGGA
AGTGGACAACGACTCGATGGTGGATCAATGTCAGCCAAAGCGAAGGGGAAGCAAAAAGCAAGACCTCCAATCAAG
TTAAGAAAAGCTAGACCAAAAGGTCGTACACTGGGAAGTCTTTCGCCGACTTCAGATGCCAGTCCTTTACCTTTG
GATCCAACGACCACTCCTCCTGTTTTCTGGACCGAAGTGTTTTCGAAACCTGATGGACGATGGCTTCCTGTCGAT
CCCATACGGAATATTGTGAACAAGCGCAAAGTTTTTGACCCGACACCATCATCTATAAATACGCCTCCGAACACT
GCCGTCGCCCACTTTTCACGCTTCAACTCGCCTGTACCGAACAAGAAGCCATCTAGAACCCAGCAAAATGCGGAA
AACCGCCTTTTATATGTATTAGCCTTTGAGGAAGATGGCTTCGCTAGGGACGTTACTCGACGTTATGCGAGGGAT
TACAGTACCAAGGTCGTGAAAGCCCAAGGTGGCAGCGGAGCTGCGAACATGGGGGGTCGAAGGGCTTGGTGGGGT
CATGTTTTGAGTATTGTTCACCGCCCCTATCGTTTGCATCGAGATGACATCGAAGACGAAGAACTTGAGACAGCT
CAAATGCTTGAAGGGATGCCAACGACTATGACAGGATTCAAGGATCATCCAGTCTACGTTCTGATACGACATCTC
AAACAAAATGAAACTTTATACCCACCACCTCCCTCTACCCCCGAACTTGGTAAATTCCGCGGAGAACCCGTTTAT
CCGAGGTCTGCTGTTGTGTCGTTGAAGACTGCGGAAAATTGGATGAGGAATGAAGGTCGTACTATCAAGACTGGT
GAACAACCTTTGAAGATGGTGAAAGTTCGTGCTGGGACAGTGAATAAACTTCGGGAATTGGAGGTTTTGAAGGAA
GCTGGAGGTAGCGGGGAGGGTAATTCGGGAGATGCTATGCAAGGGCTTTATGCGCGTTTGCAAACGGAACTTTAT
ATACCGGATCCGGTGGTTGACGGAATTATACCGAAAAATAATTTTGGGAATATAGATCTCTATACACCCTCAATG
CTCCCTCAAGGCGCAGCGCATATCCCTTATAAAGGTGTCGCGAAGGTAGCAAGAAATTTAGGGTTCGATTTCGCT
GAGGCTGTTACTGGCTTTGAGTTTAAAAAGCGACGAGCGTATCCGGTTCTAGAAGGTGTAGTCATTGCAAAAGAA
AATGAAGATACTTTACTAGAGGCGTTTTGGGAATTTGAACGGATAGCGGAGGCGAGAGCTCAAGTGAAACGTGAA
GAAAGAGTACTTAAACAATGGAAACGGTTGATTCAAGGACTTCGGATTCGGCAAAGGTTACAAGAACAATATGGA
ACAACACCAGGTGTAGTAGGAGAAGGAGGGGAAGTTGATAAAGGACAAGAAGGCAAAGTTGAGATTTCACGTCGT
GACGACAACCATAATGCCAAGGTGTTGTTGTTATCGTCGTCATCGTCGTCGTTGTCTACGCCAAAGAAGAAGGAG
AAGGAGAAGGAGAAGAATAAAAACTCCATCGTAGATGAAGATGAAGATAGGGATGGGGATCTAGTATCAGTGTTA
AAGAAGGAAAGTACCGATAAGAACGGTGAAGAAGGAGAAGATGCTTTTTCACAGATTGAAATCGAACTTGAACCA
TCTGAACATGACCACCACGACTTCATCGAAGCTGACGACGTAGTTCAAGCCTTTCATCTCCCTAAATTCCAACAT
GTCCCCGACGCTCCTGTCGTATCATTTCATCATCAACAACACTCTTCGAAATCATTAGAAAGAGGAGAAGAAAAC
TTAATGAGGGCCATACCCGATTTCGTGACTTACGATCTCGACAATGAAGACGAACAGAATGTCGAGCATCGTCAT
ATCATACCACTCAATCTCCGAGACGCCAGTAACAACAACAACAATAACACTACTGAAAATCCCACTTCTATGATG
ATCCCTAAAACCATGGCTCAATTCGCAGAAGACGCCGCGGCACAACAAGAAGTCGATCTTCAGGTTCTTACAGAA
GACATAACAAGTGTTACTAGCGTAAATGGAAATGAAGTTGAAAGGTTGAGGAGGGGTAAGGTACGGAAATTGAGT
TCTTCCGCGGCCCCGACTACTATGAATGTGAGGACAACGGGACAGAGACATCGGAATATGCTTGGTAGAACAACA
ATGGGAGGTAGGAAACGGAAACAAGGAGATGAAGATGATTTTCTTAGTGACGATGATAATGATGAAGATGAATCA
AAGAGGACAACCAACCCTACATCTACATCTACCACTACCACTATTACTCGGAAACGAAGAAAGAAAGATGTTCCT
GTATCCACGAGGACGTTACGTCCACGGAGATCAAAGAGCGTTGTCGTGTATGCTGAGAATCCTGATGATGATGAC
GACGATGAAGGATAG
Transcript >AgabiH97|104360
ATGGACGACCACCTCCTTTCGCTGGGCGCTGACAGTGACGACGATAATGACTGGGAAGAAGTCGAGTTCCCTGAA
CTACAGGACAGGACCATTGAAATTACTCTAAATGCGCAACCCAAGGCCGGCGAGGACAAGCAGAAGAGAGGTCTA
TCCCATGCAGAGCGCATACTTCGAATCGATTGCCACAAGATACATACAATCTGCTTGCTAACAAATGCATGGGTG
CGGAATAAGTATCTAAACGATGAATTACTTCACGCTCGTTTACTGTCAATATGCCCACTCAAATATCAAGATTCT
TTTGCGACAATACATAAATCACGAATCCCGGATCCGAATCAGCGGGGGCGGATGTTCGAAAACGCAGTCCGAGAC
CTCGCCAGTTGGTGGTCGTCAGCTTTCGAAGTAGTTCCAGAGGGGCATCTCCGCAATCGTACTTTCCTCGATGTT
GAAAAAGTCTTAGAACGATACCATCTTCTTTCCAACGACGATGATTCTGTTAATGGTGAAATGGACGTGGAAGTT
CTTCAGGATGTCTTGGACGAGGACGGAGAGTTCATACGGACCCCTAAAAGTCTGATGAAGCATGCTCTTATGGCA
AGAGGCTCAAGAGACACAAGTGCGCAACTTTTCACAGCTTTATGTCGGGCTCTTGGGATACCCGCTCGCCTCGTA
GCGAGTCTTCAGAGCGTGCCTTGGCAAGCAAGTGTCGGAAAACCGAAACCAAAATATGAGAAAAAGACCAAGGGC
AAAAAGAAAGGGAAAGCTACAGCTTCGGAGAGCACTTCTGTGGCCTCGGAGGGTGGAGAATCTGAAAATGAAGAT
GACATAAAAGAAATGGGTGCCTCAACTCCGACGCGGGAGTCAAAAGGAAAGGGCAAGGCTACAGACTTTCCAGGA
AGTGGACAACGACTCGATGGTGGATCAATGTCAGCCAAAGCGAAGGGGAAGCAAAAAGCAAGACCTCCAATCAAG
TTAAGAAAAGCTAGACCAAAAGGTCGTACACTGGGAAGTCTTTCGCCGACTTCAGATGCCAGTCCTTTACCTTTG
GATCCAACGACCACTCCTCCTGTTTTCTGGACCGAAGTGTTTTCGAAACCTGATGGACGATGGCTTCCTGTCGAT
CCCATACGGAATATTGTGAACAAGCGCAAAGTTTTTGACCCGACACCATCATCTATAAATACGCCTCCGAACACT
GCCGTCGCCCACTTTTCACGCTTCAACTCGCCTGTACCGAACAAGAAGCCATCTAGAACCCAGCAAAATGCGGAA
AACCGCCTTTTATATGTATTAGCCTTTGAGGAAGATGGCTTCGCTAGGGACGTTACTCGACGTTATGCGAGGGAT
TACAGTACCAAGGTCGTGAAAGCCCAAGGTGGCAGCGGAGCTGCGAACATGGGGGGTCGAAGGGCTTGGTGGGGT
CATGTTTTGAGTATTGTTCACCGCCCCTATCGTTTGCATCGAGATGACATCGAAGACGAAGAACTTGAGACAGCT
CAAATGCTTGAAGGGATGCCAACGACTATGACAGGATTCAAGGATCATCCAGTCTACGTTCTGATACGACATCTC
AAACAAAATGAAACTTTATACCCACCACCTCCCTCTACCCCCGAACTTGGTAAATTCCGCGGAGAACCCGTTTAT
CCGAGGTCTGCTGTTGTGTCGTTGAAGACTGCGGAAAATTGGATGAGGAATGAAGGTCGTACTATCAAGACTGGT
GAACAACCTTTGAAGATGGTGAAAGTTCGTGCTGGGACAGTGAATAAACTTCGGGAATTGGAGGTTTTGAAGGAA
GCTGGAGGTAGCGGGGAGGGTAATTCGGGAGATGCTATGCAAGGGCTTTATGCGCGTTTGCAAACGGAACTTTAT
ATACCGGATCCGGTGGTTGACGGAATTATACCGAAAAATAATTTTGGGAATATAGATCTCTATACACCCTCAATG
CTCCCTCAAGGCGCAGCGCATATCCCTTATAAAGGTGTCGCGAAGGTAGCAAGAAATTTAGGGTTCGATTTCGCT
GAGGCTGTTACTGGCTTTGAGTTTAAAAAGCGACGAGCGTATCCGGTTCTAGAAGGTGTAGTCATTGCAAAAGAA
AATGAAGATACTTTACTAGAGGCGTTTTGGGAATTTGAACGGATAGCGGAGGCGAGAGCTCAAGTGAAACGTGAA
GAAAGAGTACTTAAACAATGGAAACGGTTGATTCAAGGACTTCGGATTCGGCAAAGGTTACAAGAACAATATGGA
ACAACACCAGGTGTAGTAGGAGAAGGAGGGGAAGTTGATAAAGGACAAGAAGGCAAAGTTGAGATTTCACGTCGT
GACGACAACCATAATGCCAAGGTGTTGTTGTTATCGTCGTCATCGTCGTCGTTGTCTACGCCAAAGAAGAAGGAG
AAGGAGAAGGAGAAGAATAAAAACTCCATCGTAGATGAAGATGAAGATAGGGATGGGGATCTAGTATCAGTGTTA
AAGAAGGAAAGTACCGATAAGAACGGTGAAGAAGGAGAAGATGCTTTTTCACAGATTGAAATCGAACTTGAACCA
TCTGAACATGACCACCACGACTTCATCGAAGCTGACGACGTAGTTCAAGCCTTTCATCTCCCTAAATTCCAACAT
GTCCCCGACGCTCCTGTCGTATCATTTCATCATCAACAACACTCTTCGAAATCATTAGAAAGAGGAGAAGAAAAC
TTAATGAGGGCCATACCCGATTTCGTGACTTACGATCTCGACAATGAAGACGAACAGAATGTCGAGCATCGTCAT
ATCATACCACTCAATCTCCGAGACGCCAGTAACAACAACAACAATAACACTACTGAAAATCCCACTTCTATGATG
ATCCCTAAAACCATGGCTCAATTCGCAGAAGACGCCGCGGCACAACAAGAAGTCGATCTTCAGGTTCTTACAGAA
GACATAACAAGTGTTACTAGCGTAAATGGAAATGAAGTTGAAAGGTTGAGGAGGGGTAAGGTACGGAAATTGAGT
TCTTCCGCGGCCCCGACTACTATGAATGTGAGGACAACGGGACAGAGACATCGGAATATGCTTGGTAGAACAACA
ATGGGAGGTAGGAAACGGAAACAAGGAGATGAAGATGATTTTCTTAGTGACGATGATAATGATGAAGATGAATCA
AAGAGGACAACCAACCCTACATCTACATCTACCACTACCACTATTACTCGGAAACGAAGAAAGAAAGATGTTCCT
GTATCCACGAGGACGTTACGTCCACGGAGATCAAAGAGCGTTGTCGTGTATGCTGAGAATCCTGATGATGATGAC
GACGATGAAGGATAG
Gene >AgabiH97|104360
ATGGACGACCACCTCCTTTCGCTGGGCGCTGACAGTGACGACGATAATGACTGGGAAGAAGTCGAGTTCCCTGAA
CTACAGGACAGGACCATTGAAATTACTCTAAATGCGCAACCCAAGGCCGGCGAGGACAAGCAGTAGATTCGTCTC
GTTCTCCCGCAGGGACAATGACTCATAATCTTCTAGGAAGAGAGGTCTATCCCATGCAGAGCGCATACTTCGAAT
CGATTGCCACAAGATACATACAATCTGCTTGCTAACAAATGCATGGGTGCGGAATAAGTATCTAAACGATGAATT
ACTTCACGTGGGTGTCTTTGGGCTTTGGGTTTTATTCAGAGCTAATTCACTTGTACAGGCTCGTTTACTGTCAAT
ATGCCCACTCAAATATCAAGATTCTTTTGCGACAATACATAAATCACGAATCCCGGATCCGAATCAGCGGGGGCG
GATGTTCGAAAACGCAGTCCGAGACCTCGCCAGTTGGTGGTCGTCAGCTTTCGAAGTAGTTCCAGAGGGGCATCT
CCGCAATCGTACTTTCCTCGATGTTGAAAAAGTCTTAGAACGATACCATCTTCTTTCCAACGACGATGATTCTGT
TAATGGTGAAATGGACGTGGAAGTTCTTCAGGATGTCTTGGACGAGGACGGAGAGTTCATACGGACCCCTAAAAG
TCTGATGAAGCATGCTCTTATGGCAAGAGGCTCAAGAGACACAAGTGCGCAACTTTTCACAGCTTTATGTCGGGC
TCTTGGGATACCCGCTCGCCTCGTAGCGAGTCTTCAGAGCGTGCCTTGGCAAGCAAGTGTCGGAAAACCGAAACC
AAAATATGAGAAAAAGACCAAGGGCAAAAAGAAAGGGAAAGCTACAGCTTCGGAGAGCACTTCTGTGGCCTCGGA
GGGTGGAGAATCTGAAAATGAAGATGACATAAAAGAAATGGGTGCCTCAACTCCGACGCGGGAGTCAAAAGGAAA
GGGCAAGGCTACAGACTTTCCAGGAAGTGGACAACGACTCGATGGTGGATCAATGTCAGCCAAAGCGAAGGGGAA
GCAAAAAGCAAGACCTCCAATCAAGTTAAGAAAAGCTAGACCAAAAGGTCGTACACTGGGAAGTCTTTCGCCGAC
TTCAGATGCCAGTCCTTGTACGTTCACTCAATACTGACTGGCAGAGACATCAATCTCTTAGCTTTTCAATTAGTA
CCTTTGGATCCAACGACCACTCCTCCTGTTTTCTGGACCGAAGTGTTTTCGAAACCTGATGGACGATGGCTTCCT
GTCGATCCCATACGGAATATTGTGAACAAGCGCAAAGTTTTTGACCCGACACCATCATCTATAAATACGCCTCCG
AACACTGCCGTCGCCCACTTTTCACGCTTCAACTCGCCTGTACCGAACAAGAAGCCATCTAGAACCCAGCAAAAT
GCGGAAAACCGCCTTTTATATGTATTAGCCTTTGAGGAAGATGGCTTCGCTAGGGACGTTACTCGACGTTATGCG
AGGGATTACAGTACCAAGGTCGTGAAAGCCCAAGGTGGCAGCGGAGCTGCGAACATGGGGGGTCGAAGGGCTTGG
TGGGGTCATGTTTTGAGTATTGTTCACCGCCCCTATCGTTTGGTGAGCTTTTGACCCTCACTTCTGCATCGAATC
CATTTTATGAGATTCTCTACAGCATCGAGATGACATCGAAGACGAAGAACTTGAGACAGCTCAAATGCTTGAAGG
GATGCCAACGACTATGACAGGATTCAAGGATCATCCAGTGTAAGATGTCATTTAACCACTCTTGCTGTCATTAAC
TCACCAAATAAAAAAAAAGCTACGTTCTGATACGACATCTCAAACAAAATGAAACTTTATACCCACCACCTCCCT
CTACCCCCGAACTTGGTAAATTCCGCGGAGAACCCGTTTATCCGAGGTCTGCTGTTGTGTCGTTGAAGACTGCGG
AAAATTGGATGAGGAATGAAGGTCGTACTATCAAGACTGGTGAACAACCTTTGAAGATGGTGAAAGTTCGTGCTG
GGACAGTGAATAAACTTCGGGAATTGGAGGTTTTGAAGGAAGCTGGAGGTAGCGGGGAGGGTAATTCGGGAGATG
CTATGCAAGGGCTTTATGCGCGTTTGCAAACGGAACTTTATATACCGGATCCGGTGGTTGACGTGAGTCGTTTTT
ACATTTCAAGTCTAAAAGTCGAGTGATAAACTTTTATTGTTTCTTAAAGGGAATTATACCGAAAAATAATTTTGG
GAATATAGATCTCTATACACCCTCAATGCTCCCTCAAGGCGCAGCGCATATCCCTTGTAAGTTATACTCAGTCTT
GTAATCTTTTTCTTAAAAAACGCTAATCACTTCTCTATCATTCAGATAAAGGTGTCGCGAAGGTAGCAAGAAATT
TAGGGTTCGATTTCGCTGAGGCTGTTGTGCGTACACTTTTCTAATTTGTTCCAACATGCTTTCCTTTCTTAACCC
ATTATCATCGTTATTCAGACTGGCTTTGAGTTTAAAAAGCGACGAGCGTATCCGGTTCTAGAAGGTGTAGTCATT
GCAAAAGAAAATGAAGATACTTTACTAGAGGTTCGTCTTTCACCATTCTGCGACAACCCCTCATCTAAAAAAACG
CGCTTTATTTTAAAGGCGTTTTGGGAATTTGAACGGATAGCGGAGGCGAGAGCTCAAGTGAAACGTGAAGAAAGA
GTACTTAAACAATGGAAACGGTTGATTCAAGGACTTCGGATTCGGCAAAGGTTACAAGAACAATATGGAACAACA
CCAGGTGTAGTAGGAGAAGGAGGGGAAGTTGATAAAGGACAAGAAGGCAAAGTTGAGATTTCACGTCGTGACGAC
AACCATAATGCCAAGGTGTTGTTGTTATCGTCGTCATCGTCGTCGTTGTCTACGCCAAAGAAGAAGGAGAAGGAG
AAGGAGAAGAATAAAAACTCCATCGTAGATGAAGATGAAGATAGGGATGGGGATCTAGTATCAGTGTTAAAGAAG
GAAAGTACCGATAAGAACGGTGAAGAAGGAGAAGATGCTTTTTCACAGATTGAAATCGAACTTGTGCGTAATTTG
TTTCACTTTATTTTATTTTGGAAACTGATGATATTGATTTTTTACAATAGGAACCATCTGAACATGACCACCACG
ACTTCATCGAAGCTGACGACGTAGTTCAAGCCTTTCATCTCCCTAAATTCCAACATGTCCCCGACGCTCCTGTCG
TATCATTTCATCATCAACAACACTCTTCGAAATCATTAGAAAGAGGAGAAGAAAACTTAATGAGGGCCATACCCG
ATTTCGTGACTTACGATCTCGACAATGAAGACGAACAGAATGTCGAGCATCGTCATATCATACCACTCAATCTCC
GAGACGCCAGTAACAACAACAACAATAACACTACTGAAAATCCCACTTCTATGATGATCCCTAAAACCATGGCTC
AATTCGCAGAAGACGCCGCGGCACAACAAGAAGTCGATCTTCAGGTTCTTACAGAAGACATAACAAGTGTTACTA
GCGTAAATGGAAATGAAGTTGAAAGGTTGAGGAGGGGTAAGGTACGGAAATTGAGTTCTTCCGCGGCCCCGACTA
CTATGAATGTGAGGACAACGGGACAGAGACATCGGAATATGCTTGGTAGAACAACAATGGGAGGTAGGAAACGGA
AACAAGGAGATGAAGATGATTTTCTTAGTGACGATGATAATGATGAAGATGAATCAAAGAGGACAACCAACCCTA
CATCTACATCTACCACTACCACTATTACTCGGAAACGAAGAAAGAAAGATGTTCCTGTATCCACGAGGACGTTAC
GTCCACGGAGATCAAAGAGCGTTGTCGTGTATGCTGAGAATCCTGATGATGATGACGACGATGAAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail