Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|104000
Gene name
Locationscaffold_7:1730511..1734090
Strand+
Gene length (bp)3579
Transcript length (bp)2796
Coding sequence length (bp)2796
Protein length (aa) 932

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09794 Avl9 Transport protein Avl9 5.8E-127 193 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 189 622 2.0E-90
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 193 630 3.0E-89
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 188 403 7.0E-47
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 188 403 8.0E-47
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 188 403 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 189 622 2.0E-90
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 193 630 3.0E-89
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 188 403 7.0E-47
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 188 403 8.0E-47
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 188 403 1.0E-46
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 434 644 6.0E-19
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 434 644 1.0E-18
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 434 617 4.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|104000
MSSLACSTNLLSSATLGKKTDIEMEPPPTAAAHSQPDHDSDADTASQRSISLDSPPLSPRTDARDFLANPGAFLR
SDDKRESNQFTVDTDFSSDTDDMSMHKHRASVVAESPNTTAPPSIFEEEPLTATKQSINAPVDSPSSSSLPTPMA
TTYPPTPSAHDDTISISSLTSNTSSRKARPESLLVSPPEGPLVLGIALVDFNHLVGPRIEWSKGDIFNDEEVAKI
LPFLALPDGAHLSTEDYSYFHLVPPGLNTTTIFGISCNQQIASKLLLVKDPDVTRSIVQKAVVVLASKPVFGPIR
DKLRVVTSALFQQRDFTDISILDIFAVNLEPSLRGQLTESGLYMGTSLREFVHTFRHRTLILVKALILQKRIMFY
GHPVERLCTYQYSLISLIPGLLQHLEDCGSPPLSNRAPTLSRPNSLKTSDHKSMMAFMGMPLDVFGKDAFFQPYL
PLQQLDMLVGTPSWLCGSTNSIVTQQKEIDLFVDTETGMIEIRDPRLERSVALTAADRKWMDDIVNDVNANWDDE
DPGRASSMQTRFKGSDDYLRTKFEEYISAALSSVKYRDFVAKGEGNGVLITGGTGGDVASMEDFNSLWISEFRGT
NAYAVWDRITDPVIFDIIEPRHPCTDKPSVVSDLGLRLHEGIQDLKLDQQLAPAREAVARTFATGSTNFFKAVEG
VKGRWRQPSAGSIHTTTSATASTDDSGLSTPIEVSKSDFEPQHDKGGRPDVVGSPQSGTLRSFSFFSSATSTPTP
GASAVNGQSAAGSPAPAFQDHVRSASVTASTAASAAATNLTTWGAGIGSFFSSKLARTKSTDATATPTQQQEKPL
PPSAVDLKSSTSLPPLPSLVTQSPVTSTSASFRDSDSGTIFSATSPTTTVPITHKATIAGEARVVSMTTATTPLK
ESRRSVEKKAKVVEDEVSDGAGETMYSGVAL*
Coding >AgabiH97|104000
ATGTCATCATTAGCTTGCTCGACCAACTTGTTGTCCAGTGCTACGCTCGGAAAAAAAACAGACATAGAGATGGAA
CCACCGCCGACAGCCGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAGCGCTCCATC
TCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTTCTCCGC
TCGGACGACAAGCGCGAGTCCAACCAGTTCACTGTCGACACAGACTTTAGCTCGGACACAGACGACATGAGCATG
CACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAGGAGCCA
CTAACAGCGACAAAGCAGTCCATCAATGCTCCTGTGGATTCACCCTCGTCGTCTTCGCTTCCAACCCCCATGGCA
ACAACGTATCCACCCACTCCTTCAGCACACGACGACACCATTTCGATATCTTCCCTGACATCAAACACGTCTTCT
CGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTACTGGGCATCGCCCTGGTCGAC
TTCAATCACCTGGTTGGCCCTCGCATAGAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCCAAGATA
CTGCCTTTCCTTGCCCTCCCTGACGGTGCCCATCTCTCAACCGAAGACTACTCGTATTTCCACCTTGTGCCTCCC
GGTCTCAATACCACAACTATTTTTGGCATCTCATGCAATCAACAAATCGCTTCAAAATTATTACTCGTCAAAGAC
CCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTTTGGCCCAATTAGG
GACAAGTTGCGGGTAGTGACATCGGCTCTCTTTCAGCAAAGAGACTTTACGGATATTAGTATATTGGATATTTTC
GCCGTCAATTTAGAACCGAGTTTAAGAGGACAATTGACGGAAAGCGGGTTGTATATGGGTACAAGTCTCCGTGAA
TTTGTGCATACCTTCCGGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGATCATGTTTTAT
GGTCATCCCGTAGAACGACTATGTACATATCAATATTCCCTAATATCATTGATACCCGGTTTATTACAACATCTG
GAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATTCTTTGAAGACTTCCGAC
CATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGATGCATTTTTCCAACCCTATCTT
CCGCTCCAGCAGCTGGATATGCTGGTGGGAACACCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTGACCCAA
CAAAAGGAAATCGATTTATTTGTGGATACCGAAACTGGGATGATTGAGATTCGTGATCCGAGATTAGAACGTTCG
GTGGCGTTGACCGCGGCAGACCGTAAATGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGATGATGAG
GATCCGGGCAGGGCGTCAAGCATGCAAACTAGGTTCAAAGGGAGCGATGATTATCTAAGGACCAAATTTGAGGAG
TATATCTCGGCTGCGTTGTCGTCCGTTAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGGAATGGCGTATTGATC
ACTGGTGGAACTGGTGGTGATGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGAGGTACC
AATGCATATGCAGTCTGGGACCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGACACCCATGTACA
GATAAACCATCGGTCGTATCAGATCTAGGTTTACGACTACACGAAGGTATTCAAGATCTCAAACTTGATCAACAA
CTGGCACCTGCTCGAGAAGCCGTGGCTAGGACATTCGCTACTGGGTCAACGAATTTCTTCAAAGCCGTAGAAGGG
GTAAAAGGTCGATGGCGGCAGCCAAGTGCTGGTTCGATACATACTACTACCAGTGCGACAGCTTCAACGGATGAT
TCGGGTTTGAGTACACCCATTGAGGTGTCCAAATCGGATTTCGAACCTCAACACGACAAGGGGGGAAGGCCGGAT
GTGGTAGGGTCTCCACAATCGGGAACTCTAAGATCGTTTTCGTTCTTCTCTTCGGCAACATCGACGCCGACGCCA
GGCGCGAGTGCCGTAAACGGGCAGTCAGCTGCTGGTAGTCCGGCCCCCGCGTTCCAGGATCACGTCAGAAGTGCT
TCTGTAACGGCGTCTACGGCAGCTTCTGCTGCAGCGACCAACTTGACGACTTGGGGTGCTGGGATTGGATCATTT
TTCTCGTCAAAGTTGGCGAGGACTAAATCGACTGATGCTACTGCTACCCCCACTCAGCAGCAGGAGAAACCGTTA
CCACCTAGTGCTGTGGATTTGAAATCTTCGACTTCACTTCCTCCTTTACCTTCTTTGGTTACACAGTCGCCGGTG
ACATCGACTTCGGCTAGTTTTAGAGATTCGGACTCAGGAACTATATTTTCGGCGACGTCGCCAACGACTACGGTA
CCGATCACACATAAGGCGACTATCGCTGGAGAGGCGCGTGTGGTATCAATGACGACGGCGACTACTCCGTTGAAG
GAAAGTAGAAGGAGTGTTGAGAAGAAAGCAAAGGTGGTTGAAGATGAAGTTTCGGATGGGGCGGGTGAGACGATG
TATAGTGGTGTGGCGTTGTAG
Transcript >AgabiH97|104000
ATGTCATCATTAGCTTGCTCGACCAACTTGTTGTCCAGTGCTACGCTCGGAAAAAAAACAGACATAGAGATGGAA
CCACCGCCGACAGCCGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAGCGCTCCATC
TCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTTCTCCGC
TCGGACGACAAGCGCGAGTCCAACCAGTTCACTGTCGACACAGACTTTAGCTCGGACACAGACGACATGAGCATG
CACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAGGAGCCA
CTAACAGCGACAAAGCAGTCCATCAATGCTCCTGTGGATTCACCCTCGTCGTCTTCGCTTCCAACCCCCATGGCA
ACAACGTATCCACCCACTCCTTCAGCACACGACGACACCATTTCGATATCTTCCCTGACATCAAACACGTCTTCT
CGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTACTGGGCATCGCCCTGGTCGAC
TTCAATCACCTGGTTGGCCCTCGCATAGAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCCAAGATA
CTGCCTTTCCTTGCCCTCCCTGACGGTGCCCATCTCTCAACCGAAGACTACTCGTATTTCCACCTTGTGCCTCCC
GGTCTCAATACCACAACTATTTTTGGCATCTCATGCAATCAACAAATCGCTTCAAAATTATTACTCGTCAAAGAC
CCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTTTGGCCCAATTAGG
GACAAGTTGCGGGTAGTGACATCGGCTCTCTTTCAGCAAAGAGACTTTACGGATATTAGTATATTGGATATTTTC
GCCGTCAATTTAGAACCGAGTTTAAGAGGACAATTGACGGAAAGCGGGTTGTATATGGGTACAAGTCTCCGTGAA
TTTGTGCATACCTTCCGGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGATCATGTTTTAT
GGTCATCCCGTAGAACGACTATGTACATATCAATATTCCCTAATATCATTGATACCCGGTTTATTACAACATCTG
GAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATTCTTTGAAGACTTCCGAC
CATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGATGCATTTTTCCAACCCTATCTT
CCGCTCCAGCAGCTGGATATGCTGGTGGGAACACCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTGACCCAA
CAAAAGGAAATCGATTTATTTGTGGATACCGAAACTGGGATGATTGAGATTCGTGATCCGAGATTAGAACGTTCG
GTGGCGTTGACCGCGGCAGACCGTAAATGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGATGATGAG
GATCCGGGCAGGGCGTCAAGCATGCAAACTAGGTTCAAAGGGAGCGATGATTATCTAAGGACCAAATTTGAGGAG
TATATCTCGGCTGCGTTGTCGTCCGTTAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGGAATGGCGTATTGATC
ACTGGTGGAACTGGTGGTGATGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGAGGTACC
AATGCATATGCAGTCTGGGACCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGACACCCATGTACA
GATAAACCATCGGTCGTATCAGATCTAGGTTTACGACTACACGAAGGTATTCAAGATCTCAAACTTGATCAACAA
CTGGCACCTGCTCGAGAAGCCGTGGCTAGGACATTCGCTACTGGGTCAACGAATTTCTTCAAAGCCGTAGAAGGG
GTAAAAGGTCGATGGCGGCAGCCAAGTGCTGGTTCGATACATACTACTACCAGTGCGACAGCTTCAACGGATGAT
TCGGGTTTGAGTACACCCATTGAGGTGTCCAAATCGGATTTCGAACCTCAACACGACAAGGGGGGAAGGCCGGAT
GTGGTAGGGTCTCCACAATCGGGAACTCTAAGATCGTTTTCGTTCTTCTCTTCGGCAACATCGACGCCGACGCCA
GGCGCGAGTGCCGTAAACGGGCAGTCAGCTGCTGGTAGTCCGGCCCCCGCGTTCCAGGATCACGTCAGAAGTGCT
TCTGTAACGGCGTCTACGGCAGCTTCTGCTGCAGCGACCAACTTGACGACTTGGGGTGCTGGGATTGGATCATTT
TTCTCGTCAAAGTTGGCGAGGACTAAATCGACTGATGCTACTGCTACCCCCACTCAGCAGCAGGAGAAACCGTTA
CCACCTAGTGCTGTGGATTTGAAATCTTCGACTTCACTTCCTCCTTTACCTTCTTTGGTTACACAGTCGCCGGTG
ACATCGACTTCGGCTAGTTTTAGAGATTCGGACTCAGGAACTATATTTTCGGCGACGTCGCCAACGACTACGGTA
CCGATCACACATAAGGCGACTATCGCTGGAGAGGCGCGTGTGGTATCAATGACGACGGCGACTACTCCGTTGAAG
GAAAGTAGAAGGAGTGTTGAGAAGAAAGCAAAGGTGGTTGAAGATGAAGTTTCGGATGGGGCGGGTGAGACGATG
TATAGTGGTGTGGCGTTGTAG
Gene >AgabiH97|104000
ATGTCATCATTAGCTTGCTCGACCAACTTGTTGTCCAGTGCTACGCTCGGAAAAAAAACAGACATAGAGATGGAA
CCACCGCCGACAGCCGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAGCGCTCCATC
TCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTTCTCCGC
TCGGACGACAAGCGCGAGTCCAACCAGTTCACTGTCGACACAGACTTTAGCTCGGACACAGACGACATGAGCATG
CACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAGGAGCCA
CTAACAGCGACAAAGCAGTCCATCAATGCTCCTGTGGATTCACCCTCGTCGTCTTCGCTTCCAACCCCCATGGCA
ACAACGTATCCACCCACTCCTTCAGCACACGACGACACCATTTCGATATCTTCCCTGACATCAAACACGTCTTCT
CGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTACTGGGCATCGCCCTGGTCGAC
TTCAATCACCTGGTCAGTCGTTCGTTTTAATTCCAGAACATAAACTCATGCAGCTCACAGGTTGGCCCTCGCATA
GAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCCAAGATACTGCCTTTCCTTGCCCTCCCTGACGGT
GCCCATCTCGTCAGTCTTTCTATCATCTTAATTTCGATGTACCCTGAAAACTCGTTTAGTCAACCGAAGACTACT
CGTATTTCCACCTTGTGCCTCCCGGTCTCAATACCACAACTATTTTTGGCATCTCGCAAGTCTGATTATCGAACA
AGATTTGTATCATGGCCTTATATGCATTCTGATTCTTAGATGCAATCAACAAATCGCTTCAAAATTATTACTCGT
CAAAGACCCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTTTGGCCC
AATTAGGTATGCTCACTCCCTTTGACGGCGAATCAATTGTGTAGACCACCCATTATAGGGACAAGTTGCGGGTAG
TGACATCGGCTCTCTTTCAGCAAAGGTGCGTCAATAGAATATCCTGCCATACATACTCGTAGCTCATACATCTAC
AGAGACTTTACGGATATTAGTATATTGGATATTTTCGCCGTCAATTTAGAACCGAGTTTAAGAGGACAATTGACG
GAAAGCGGGTTGTATATGGGTGTGTGACGCGCCTTTCTCTTGAAAATGTCTTCTGAATAATTCTACAGGTACAAG
TCTGTGCGTGCCTTCCACCTATCCACAGCGTTGTTTAATCATACTTGATTAGCCGTGAATTTGTGCATACCTTCC
GGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGGTGAGCTTTACTCTGCTGGGTGTATGCT
TGAATCTGACTGCTCGTAGATCATGTTTTATGGTCATCCCGTAGAACGACTATGTACATATCAATATTCCCTAAT
ATCATTGATACCCGGTAAACGTCTCTGCTCCCTTCAATCAATGCTTTTCTGATACCTCCGCTAGGTTTATTACAA
CATCTGGAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATTCTTTGAAGACT
TCCGACCATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGTAATGTCTACTGGTATG
GCATCTAAATCATTTGACCCATTGAGTTTTTTTGAAATCAGGATGCATTTTTCCAACCCTATCTTCCGCTCCAGC
AGCTGGATATGCTGGTGGGAACACCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTGACCCAACAAAAGGAAA
TCGATTTATTTGTGGATGTACGTCCGAGAGAACTCTTTTATTGACAAATTTCTTTGTGGCTCATTGGATTGTCAG
ACCGAAACTGGGATGATTGAGATTCGTGATCCGAGATTAGAACGTTCGGTGGCGTTGACCGCGGCAGACCGTAAA
TGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGATGATGAGGATCCGGGCAGGGCGTCAAGCATGCAG
TGCGTCATTCCACTCTGTCTTACTCGTGAATAGCTAAGTCGTTGACTGAAGAACTAGGTTCAAAGGGAGCGATGA
TTATCTAAGGACCAAAGTGCGTTGATCCATTCTGTCTGGTTACGAGTGCTAATATATGTGGATAGTTTGAGGAGT
ATATCTCGGCTGCGTTGTCGTCCGTTAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGGAATGGCGTATTGATCA
CTGGTGGAACTGGTATGTTCTTGTCGCTTATTGGTTGTACAGTCCAACTCTGATGACTGTTTGTATAGGTGGTGA
TGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGAGGTACCAATGCATATGCAGTCTGGGA
CCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGGTGAGCATATTCCTTCTTTTCACCAGCACCGGC
ATAGATTGATACGTGCATAGACACCCATGTACAGATAAACCATCGGTCGTATCAGATCTAGGTTTACGACTACAC
GAAGGTATTCAAGATCTCAAACTTGATCAACAACTGGCACCTGCTCGAGAAGCCGTGGCTAGGACATTCGCTACT
GGGTCAACGAATTTCTTCAAAGCCGTAGAAGGGGTAAAAGGTCGATGGCGGCAGCCAAGTGCTGGTTCGATACAT
ACTACTACCAGTGCGACAGCTTCAACGGATGATTCGGGTTTGAGTACACCCATTGAGGTGTCCAAATCGGATTTC
GAACCTCAACACGACAAGGGGGGAAGGCCGGATGTGGTAGGGTCTCCACAATCGGGAACTCTAAGATCGTTTTCG
TTCTTCTCTTCGGCAACATCGACGCCGACGCCAGGCGCGAGTGCCGTAAACGGGCAGTCAGCTGCTGGTAGTCCG
GCCCCCGCGTTCCAGGATCACGTCAGAAGTGCTTCTGTAACGGCGTCTACGGCAGCTTCTGCTGCAGCGACCAAC
TTGACGACTTGGGGTGCTGGGATTGGATCATTTTTCTCGTCAAAGTTGGCGAGGACTAAATCGACTGATGCTACT
GCTACCCCCACTCAGCAGCAGGAGAAACCGTTACCACCTAGTGCTGTGGATTTGAAATCTTCGACTTCACTTCCT
CCTTTACCTTCTTTGGTTACACAGTCGCCGGTGACATCGACTTCGGCTAGTTTTAGAGATTCGGACTCAGGAACT
ATATTTTCGGCGACGTCGCCAACGACTACGGTACCGATCACACATAAGGCGACTATCGCTGGAGAGGCGCGTGTG
GTATCAATGACGACGGCGACTACTCCGTTGAAGGAAAGTAGAAGGAGTGTTGAGAAGAAAGCAAAGGTGGTTGAA
GATGAAGTTTCGGATGGGGCGGGTGAGACGATGTATAGTGGTGTGGCGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail