Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103950
Gene name
Locationscaffold_7:1720713..1723543
Strand+
Gene length (bp)2830
Transcript length (bp)2652
Coding sequence length (bp)2652
Protein length (aa) 884

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07738 Sad1_UNC Sad1 / UNC-like C-terminal 4.2E-25 178 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59729|SLPI_SCHPO Uncharacterized protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.09 PE=3 SV=1 161 309 5.0E-41
sp|Q12232|SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLP1 PE=1 SV=1 161 324 5.0E-35
sp|Q54MI3|SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum GN=sun2 PE=3 SV=1 160 308 3.0E-31
sp|Q8C341|SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus GN=Suco PE=1 SV=3 160 321 4.0E-29
sp|Q9UBS9|SUCO_HUMAN SUN domain-containing ossification factor OS=Homo sapiens GN=SUCO PE=1 SV=1 160 321 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59729|SLPI_SCHPO Uncharacterized protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.09 PE=3 SV=1 161 309 5.0E-41
sp|Q12232|SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLP1 PE=1 SV=1 161 324 5.0E-35
sp|Q54MI3|SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum GN=sun2 PE=3 SV=1 160 308 3.0E-31
sp|Q8C341|SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus GN=Suco PE=1 SV=3 160 321 4.0E-29
sp|Q9UBS9|SUCO_HUMAN SUN domain-containing ossification factor OS=Homo sapiens GN=SUCO PE=1 SV=1 160 321 4.0E-29
sp|Q710E6|SUCO_RAT SUN domain-containing ossification factor OS=Rattus norvegicus GN=Suco PE=2 SV=1 160 321 8.0E-29
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103950
MLESGCCAKLHKPLSPIIVVLLLVWVAFATAESAESTSYNDPCRVISLSAPKPAEPPMCYLKPLRLLEPVQEDLL
LSFEEWKAKQHHGAETGPPAGVTSDNGSEVGDGMGNGSKPPKAEDASSIRSSGQEVHQSQASGRSKESPPHPSPQ
FPVPIVPIVDRFNYASLDCSARVHKAHKEAKHSSNILSSKKDRYLLSPCKTKEPQFVIIELCEDIRVDVVELANF
EFFSGVFKDVTVSVAKTSWEEARWTVLGTWKAKNVRGIQTFRPPIPLKGFYRYLRIDFHSHYGSEYYCPVSLVAV
YGFTHLEEWNWELYEAERTKLDAISPEASIHQTPDSAKTDSAGVIFGQETTLPTDSPEEDVIPSTLLTKILQPST
DPHILPPFIITQFYDFEAPYVAPSSTKTSTSSPTPFSATYHPTASPSSARISPASHPNTANTITSSPVETNVLPT
CTTSSTVLMSTPVSGSQGSLPLSVSGGESIFRTIMNRVLELESNHTLYEQYMAQQQFLVREALKRLGEDIGRLEG
VGKAHRQIHDRATQEWEKQRKRWQFEHAQLLQRIDYLTDEIIMEKRLGVAQLCLLLAVLVFMGLTRGSRGPIDAD
RRRWGTALKSFSDDWRHRRTESGTDGSHVRTLSSMLPVIPLRSAESGSNHSSGEIYEKISSATPPLTSIDLNILS
HHDQRQQRRRGRGDHGSENVQNVYLQVDGGSRSRSRTTSGPRRRTSSRIRGQGSTSRQALEARHSRAPSVANTPT
KGVRASPTVGSIRLNVYDSKRGDSVRRSHSSQGTIDLALEEAWGGSRGNGKSARTWARTAHLHEVKQKRQRNNSG
SLFSGSINGDKHSEYSESTKDNDSDVFGGTEKPELLVTNTAGVETDADGWESASDVEY*
Coding >AgabiH97|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGGAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCGCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCACAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGACCTTTCGCCCACCGATTCCACTAAAAGGATTC
TATCGGTACCTTCGGATCGATTTTCACTCGCATTATGGATCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTT
TACGGATTCACGCATCTGGAGGAGTGGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCA
CCAGAGGCTTCTATTCATCAGACACCAGATTCGGCCAAAACCGATAGCGCAGGAGTCATATTTGGCCAAGAGACC
ACTCTACCAACCGACTCTCCAGAGGAGGATGTAATCCCCTCAACCTTGCTTACCAAAATTCTACAACCCTCCACC
GATCCTCACATCTTACCTCCGTTTATCATCACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGC
ACCAAGACATCCACATCTTCTCCAACACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGT
ATATCACCAGCGTCTCATCCTAACACAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACC
TGTACCACTTCTTCCACTGTCCTAATGTCGACCCCGGTTTCCGGTTCCCAAGGTTCCCTCCCATTATCGGTCTCC
GGTGGAGAGTCCATCTTTCGCACCATTATGAATAGAGTACTGGAACTGGAAAGCAATCACACACTATACGAGCAG
TATATGGCACAACAGCAATTCCTTGTACGCGAAGCATTGAAACGATTAGGCGAAGACATTGGACGGCTTGAAGGC
GTGGGAAAGGCTCACCGACAAATACATGATAGAGCAACACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTC
GAACATGCACAACTCCTTCAGCGAATAGACTATTTGACTGATGAGATCATCATGGAAAAGCGTCTGGGAGTCGCC
CAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCGTGGCTCTCGGGGACCAATTGATGCGGAC
CGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCGTCATCGGAGAACAGAGTCTGGAACTGAT
GGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATTACGATCTGCGGAGTCTGGCTCAAATCAC
TCTTCAGGTGAAATCTACGAGAAAATCTCATCTGCTACGCCCCCCCTCACAAGCATCGACTTAAATATCCTCTCT
CATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGGGTCGGAAAACGTGCAGAACGTTTACCTT
CAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACCACGTCGCCGGACTTCCTCCCGGATTCGA
GGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAGCACGTCATAGTCGTGCACCTAGTGTTGCGAATACACCAACA
AAAGGCGTTAGAGCCAGTCCCACAGTGGGATCCATCAGGCTCAACGTTTATGACTCGAAGCGTGGGGATTCAGTG
CGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGAAGCCTGGGGTGGATCAAGAGGTAATGGT
AAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAAGCAGAAGCGGCAACGGAATAATTCAGGG
TCTTTGTTCAGCGGTAGCATTAACGGTGATAAGCACTCGGAATATTCAGAAAGTACAAAAGACAATGACTCGGAC
GTCTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGCGGGTGTGGAAACTGATGCTGATGGTTGG
GAAAGCGCTAGTGATGTAGAATATTGA
Transcript >AgabiH97|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGGAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCGCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCACAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGACCTTTCGCCCACCGATTCCACTAAAAGGATTC
TATCGGTACCTTCGGATCGATTTTCACTCGCATTATGGATCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTT
TACGGATTCACGCATCTGGAGGAGTGGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCA
CCAGAGGCTTCTATTCATCAGACACCAGATTCGGCCAAAACCGATAGCGCAGGAGTCATATTTGGCCAAGAGACC
ACTCTACCAACCGACTCTCCAGAGGAGGATGTAATCCCCTCAACCTTGCTTACCAAAATTCTACAACCCTCCACC
GATCCTCACATCTTACCTCCGTTTATCATCACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGC
ACCAAGACATCCACATCTTCTCCAACACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGT
ATATCACCAGCGTCTCATCCTAACACAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACC
TGTACCACTTCTTCCACTGTCCTAATGTCGACCCCGGTTTCCGGTTCCCAAGGTTCCCTCCCATTATCGGTCTCC
GGTGGAGAGTCCATCTTTCGCACCATTATGAATAGAGTACTGGAACTGGAAAGCAATCACACACTATACGAGCAG
TATATGGCACAACAGCAATTCCTTGTACGCGAAGCATTGAAACGATTAGGCGAAGACATTGGACGGCTTGAAGGC
GTGGGAAAGGCTCACCGACAAATACATGATAGAGCAACACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTC
GAACATGCACAACTCCTTCAGCGAATAGACTATTTGACTGATGAGATCATCATGGAAAAGCGTCTGGGAGTCGCC
CAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCGTGGCTCTCGGGGACCAATTGATGCGGAC
CGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCGTCATCGGAGAACAGAGTCTGGAACTGAT
GGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATTACGATCTGCGGAGTCTGGCTCAAATCAC
TCTTCAGGTGAAATCTACGAGAAAATCTCATCTGCTACGCCCCCCCTCACAAGCATCGACTTAAATATCCTCTCT
CATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGGGTCGGAAAACGTGCAGAACGTTTACCTT
CAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACCACGTCGCCGGACTTCCTCCCGGATTCGA
GGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAGCACGTCATAGTCGTGCACCTAGTGTTGCGAATACACCAACA
AAAGGCGTTAGAGCCAGTCCCACAGTGGGATCCATCAGGCTCAACGTTTATGACTCGAAGCGTGGGGATTCAGTG
CGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGAAGCCTGGGGTGGATCAAGAGGTAATGGT
AAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAAGCAGAAGCGGCAACGGAATAATTCAGGG
TCTTTGTTCAGCGGTAGCATTAACGGTGATAAGCACTCGGAATATTCAGAAAGTACAAAAGACAATGACTCGGAC
GTCTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGCGGGTGTGGAAACTGATGCTGATGGTTGG
GAAAGCGCTAGTGATGTAGAATATTGA
Gene >AgabiH97|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGGAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCGCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCACAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGGTGTGTCTGTCTATGTAGCTTCTACATTGTGTG
TGAGCTTACATTCTATTAGACCTTTCGCCCACCGATTCCACTAAAAGGATTCTATCGGTACCTTCGGATCGATTT
TCACTCGCATTATGGATCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTTTACGGATTCACGCATCTGGAGGA
GTGGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCACCAGAGGCTTCTATTCATCAGAC
ACCAGATTCGGCCAAAACCGATAGCGCAGGAGTCATATTTGGCCAAGAGACCACTCTACCAACCGACTCTCCAGA
GGAGGATGTAATCCCCTCAACCTTGCTTACCAAAATTCTACAACCCTCCACCGATCCTCACATCTTACCTCCGTT
TATCATCACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGCACCAAGACATCCACATCTTCTCC
AACACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGTATATCACCAGCGTCTCATCCTAA
CACAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACCTGTACCACTTCTTCCACTGTCCT
AATGTCGACCCCGGTTTCCGGTTCCCAAGGTTCCCTCCCATTATCGGTCTCCGGTGGAGAGTCCATCTTTCGCAC
CATTATGAATAGAGTACTGGAACTGGAAAGCAATCACACACTATACGAGCAGTATATGGCACAACAGCAATTCCT
TGTACGCGAAGCATTGAAACGATTAGGCGAAGACATTGGACGGCTTGAAGGCGTGGTTCGTTGCTTCACGATTCC
CCAGAATTTTTACCAATTTAAAGATGTTTCTTTATTAATCAGGGAAAGGCTCACCGACAAATACATGATAGAGCA
ACACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTCGAACATGCACAACTCCTTCAGCGAATAGACTATTTG
ACTGATGAGGTAAATGACTCGAATTTATCGGCCAATTACCTGCCTTGTTCACAGATCCTGCTTTATTATTCAGAT
CATCATGGAAAAGCGTCTGGGAGTCGCCCAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCG
TGGCTCTCGGGGACCAATTGATGCGGACCGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCG
TCATCGGAGAACAGAGTCTGGAACTGATGGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATT
ACGATCTGCGGAGTCTGGCTCAAATCACTCTTCAGGTGAAATCTACGAGAAAATCTCATCTGCTACGCCCCCCCT
CACAAGCATCGACTTAAATATCCTCTCTCATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGG
GTCGGAAAACGTGCAGAACGTTTACCTTCAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACC
ACGTCGCCGGACTTCCTCCCGGATTCGAGGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAGCACGTCATAGTCG
TGCACCTAGTGTTGCGAATACACCAACAAAAGGCGTTAGAGCCAGTCCCACAGTGGGATCCATCAGGCTCAACGT
TTATGACTCGAAGCGTGGGGATTCAGTGCGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGA
AGCCTGGGGTGGATCAAGAGGTAATGGTAAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAA
GCAGAAGCGGCAACGGAATAATTCAGGGTCTTTGTTCAGCGGTAGCATTAACGGTGATAAGCACTCGGAATATTC
AGAAAGTACAAAAGACAATGACTCGGACGTCTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGC
GGGTGTGGAAACTGATGCTGATGGTTGGGAAAGCGCTAGTGATGTAGAATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail