Protein ID | AgabiH97|103750 |
Gene name | |
Location | scaffold_7:1679315..1680300 |
Strand | + |
Gene length (bp) | 985 |
Transcript length (bp) | 762 |
Coding sequence length (bp) | 762 |
Protein length (aa) | 254 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF13561 | adh_short_C2 | Enoyl-(Acyl carrier protein) reductase | 1.8E-58 | 15 | 251 |
PF00106 | adh_short | short chain dehydrogenase | 2.8E-47 | 9 | 199 |
PF08659 | KR | KR domain | 9.3E-07 | 12 | 148 |
PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 2.0E-05 | 12 | 224 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q00791|STCU_EMENI | Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 | 6 | 250 | 7.0E-50 |
sp|Q08632|SDR1_PICAB | Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 | 6 | 252 | 4.0E-49 |
sp|Q49117|Y182_METEA | Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 | 6 | 250 | 4.0E-48 |
sp|P50161|AFLM_ASPPA | Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 | 4 | 250 | 2.0E-47 |
sp|P87025|THR1_COLOR | Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 | 1 | 249 | 7.0E-46 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q00791|STCU_EMENI | Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 | 6 | 250 | 7.0E-50 |
sp|Q08632|SDR1_PICAB | Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 | 6 | 252 | 4.0E-49 |
sp|Q49117|Y182_METEA | Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 | 6 | 250 | 4.0E-48 |
sp|P50161|AFLM_ASPPA | Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 | 4 | 250 | 2.0E-47 |
sp|P87025|THR1_COLOR | Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 | 1 | 249 | 7.0E-46 |
sp|Q12634|T4HR_MAGO7 | Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 | 3 | 250 | 1.0E-41 |
sp|P51831|FABG_BACSU | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 | 6 | 253 | 8.0E-41 |
sp|Q9MA93|GRDH2_ARATH | Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 | 3 | 253 | 4.0E-39 |
sp|P0A0I0|FABG_STAAW | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 | 9 | 253 | 9.0E-39 |
sp|Q6G9Y2|FABG_STAAS | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 | 9 | 253 | 9.0E-39 |
sp|Q6GHK4|FABG_STAAR | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 | 9 | 253 | 9.0E-39 |
sp|P99093|FABG_STAAN | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 | 9 | 253 | 9.0E-39 |
sp|P0A0H9|FABG_STAAM | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 | 9 | 253 | 9.0E-39 |
sp|Q5HGK2|FABG_STAAC | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 | 9 | 253 | 9.0E-39 |
sp|Q8CPI3|FABG_STAES | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 | 9 | 253 | 5.0E-38 |
sp|Q5HPW0|FABG_STAEQ | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 | 9 | 253 | 5.0E-38 |
sp|Q9FZ42|GRDH1_ARATH | Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 | 3 | 253 | 4.0E-37 |
sp|Q5KTS5|GRDH_DAUCA | Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 | 6 | 253 | 4.0E-36 |
sp|P80869|DHG2_BACSU | Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 | 4 | 253 | 5.0E-32 |
sp|P80873|GS39_BACSU | General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 | 6 | 253 | 2.0E-31 |
sp|O07575|YHDF_BACSU | Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 | 6 | 253 | 3.0E-31 |
sp|O54438|FABG_PSEAE | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 | 5 | 253 | 4.0E-31 |
sp|Q9KQH7|FABG_VIBCH | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 | 5 | 253 | 1.0E-30 |
sp|Q10216|YAY8_SCHPO | Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 | 6 | 253 | 2.0E-30 |
sp|G5EGA6|DHRS4_CAEEL | Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 | 3 | 250 | 3.0E-30 |
sp|Q9X248|FABG_THEMA | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 | 6 | 253 | 4.0E-30 |
sp|Q75KH3|GRDH_ORYSJ | Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 | 6 | 253 | 3.0E-29 |
sp|P39483|DHG2_BACME | Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 | 6 | 251 | 5.0E-29 |
sp|P40397|YHXC_BACSU | Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 | 4 | 253 | 7.0E-29 |
sp|P0A2D1|UCPA_SALTY | Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 | 6 | 249 | 1.0E-28 |
sp|P0A2D2|UCPA_SALTI | Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 | 6 | 249 | 1.0E-28 |
sp|O31767|YMFI_BACSU | Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 | 9 | 251 | 1.0E-28 |
sp|P0AET8|HDHA_ECOLI | 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 | 6 | 252 | 1.0E-28 |
sp|P0AET9|HDHA_ECO57 | 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 | 6 | 252 | 1.0E-28 |
sp|P9WGQ9|Y769_MYCTU | Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 | 9 | 253 | 2.0E-28 |
sp|P9WGQ8|Y769_MYCTO | Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 | 9 | 253 | 2.0E-28 |
sp|P33207|FABG_ARATH | 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 | 4 | 253 | 2.0E-28 |
sp|P39333|BDCA_ECOLI | Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 | 5 | 251 | 2.0E-28 |
sp|Q988B7|PLDH_RHILO | Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 | 3 | 252 | 4.0E-28 |
sp|P0AG84|YGHA_ECOLI | Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 | 6 | 243 | 8.0E-28 |
sp|P0AG85|YGHA_ECO57 | Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 | 6 | 243 | 8.0E-28 |
sp|P46331|YXBG_BACSU | Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 | 6 | 252 | 8.0E-28 |
sp|P50162|TRN1_DATST | Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 | 5 | 251 | 9.0E-28 |
sp|P39640|BACC_BACSU | Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 | 5 | 251 | 9.0E-28 |
sp|P73574|FABG1_SYNY3 | 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 | 5 | 253 | 1.0E-27 |
sp|P71079|FABL_BACSU | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 | 9 | 250 | 1.0E-27 |
sp|P0A2C9|FABG_SALTY | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 | 5 | 253 | 2.0E-27 |
sp|P0A2D0|FABG_SALTI | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 | 5 | 253 | 2.0E-27 |
sp|P43713|FABG_HAEIN | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 | 6 | 253 | 2.0E-27 |
sp|O31642|YJDA_BACSU | Uncharacterized oxidoreductase YjdA OS=Bacillus subtilis (strain 168) GN=yjdA PE=3 SV=1 | 9 | 252 | 2.0E-27 |
sp|P50941|FABG_RICPR | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 | 6 | 253 | 2.0E-27 |
sp|Q9WYG0|Y325_THEMA | Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 | 5 | 250 | 3.0E-27 |
sp|Q93X68|FABG5_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 | 10 | 253 | 4.0E-27 |
sp|F4IKM1|TRNHB_ARATH | Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 | 5 | 253 | 4.0E-27 |
sp|Q9L9F8|NOVJ_STRNV | Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 | 10 | 250 | 5.0E-27 |
sp|P0AEK3|FABG_SHIFL | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 | 5 | 253 | 6.0E-27 |
sp|P0AEK2|FABG_ECOLI | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 | 5 | 253 | 6.0E-27 |
sp|P39482|DHG1_BACME | Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 | 4 | 251 | 6.0E-27 |
sp|Q949M3|FABG3_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 | 10 | 253 | 8.0E-27 |
sp|P55336|FABG_VIBHA | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 | 4 | 253 | 9.0E-27 |
sp|Q93X62|FABG1_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 | 10 | 253 | 9.0E-27 |
sp|P37769|KDUD_ECOLI | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 | 5 | 252 | 1.0E-26 |
sp|P40288|DHG_BACME | Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 | 4 | 251 | 2.0E-26 |
sp|P55541|Y4LA_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 | 4 | 252 | 2.0E-26 |
sp|P39484|DHG3_BACME | Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 | 6 | 251 | 2.0E-26 |
sp|Q48436|BUDC_KLEPN | Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 | 9 | 252 | 2.0E-26 |
sp|Q949M2|FABG4_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 | 10 | 253 | 3.0E-26 |
sp|P40398|YHXD_BACSU | Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 | 6 | 243 | 4.0E-26 |
sp|Q5P5I4|PED_AROAE | (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 | 3 | 252 | 4.0E-26 |
sp|Q68VY7|FABG_RICTY | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 | 6 | 253 | 4.0E-26 |
sp|Q8KWT4|BACC_BACIU | Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 | 5 | 251 | 4.0E-26 |
sp|Q93X67|FABG2_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 | 10 | 253 | 4.0E-26 |
sp|Q9C826|ABA2_ARATH | Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 | 4 | 253 | 5.0E-26 |
sp|P10528|DHGA_BACME | Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 | 6 | 251 | 6.0E-26 |
sp|Q45219|Y2146_BRADU | Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 | 8 | 252 | 6.0E-26 |
sp|P12310|DHG_BACSU | Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 | 6 | 251 | 7.0E-26 |
sp|O31680|YKVO_BACSU | Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 | 8 | 251 | 9.0E-26 |
sp|P50165|TRNH_DATST | Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 | 5 | 253 | 1.0E-25 |
sp|A7DY56|TRN1_COCOF | Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 | 5 | 253 | 2.0E-25 |
sp|P50198|LINX_SPHPI | 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 | 6 | 253 | 2.0E-25 |
sp|Q05528|KDUD_DICD3 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 | 1 | 252 | 2.0E-25 |
sp|G0RNA2|LXR4_HYPJQ | L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 | 8 | 251 | 2.0E-25 |
sp|P28643|FABG_CUPLA | 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 | 2 | 253 | 2.0E-25 |
sp|P0DKI3|TRNH1_ARATH | Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 | 5 | 253 | 2.0E-25 |
sp|P37440|UCPA_ECOLI | Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 | 6 | 249 | 2.0E-25 |
sp|P39485|DHG4_BACME | Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 | 6 | 251 | 3.0E-25 |
sp|Q8XBJ4|UCPA_ECO57 | Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 | 6 | 249 | 4.0E-25 |
sp|P66776|BUTA_STAAW | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 | 9 | 250 | 4.0E-25 |
sp|Q6GCZ8|BUTA_STAAS | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 | 9 | 250 | 4.0E-25 |
sp|Q6GKH9|BUTA_STAAR | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 | 9 | 250 | 4.0E-25 |
sp|P99120|BUTA_STAAN | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 | 9 | 250 | 4.0E-25 |
sp|P66775|BUTA_STAAM | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 | 9 | 250 | 4.0E-25 |
sp|Q5HJP2|BUTA_STAAC | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 | 9 | 250 | 4.0E-25 |
sp|Q9ZW14|TRNH8_ARATH | Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 | 5 | 253 | 5.0E-25 |
sp|Q5HKG6|BUTA_STAEQ | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 | 9 | 252 | 5.0E-25 |
sp|P38004|FABG_CHLTR | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 | 6 | 251 | 6.0E-25 |
sp|P50199|GNO_GLUOX | Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 | 5 | 253 | 7.0E-25 |
sp|P17611|NODG_AZOBR | Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 | 6 | 251 | 7.0E-25 |
sp|Q9ZW04|TRNH4_ARATH | Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 | 5 | 253 | 1.0E-24 |
sp|Q5RCF8|DHRS4_PONAB | Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 | 6 | 250 | 1.0E-24 |
sp|Q9X6U2|BDHA_CUPNH | D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 | 6 | 252 | 1.0E-24 |
sp|P07999|DHGB_BACME | Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 | 4 | 251 | 2.0E-24 |
sp|Q8CQD2|BUTA_STAES | Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 | 9 | 252 | 2.0E-24 |
sp|P33368|YOHF_ECOLI | Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 | 9 | 253 | 2.0E-24 |
sp|Q9BTZ2|DHRS4_HUMAN | Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 | 6 | 250 | 3.0E-24 |
sp|Q13268|DHRS2_HUMAN | Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 | 6 | 245 | 5.0E-24 |
sp|P41177|DHKR_STRCM | Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 | 3 | 251 | 7.0E-24 |
sp|O67610|FABG_AQUAE | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 | 6 | 251 | 9.0E-24 |
sp|P94681|TSAC_COMTE | 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 | 5 | 250 | 9.0E-24 |
sp|Q9PKF7|FABG_CHLMU | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 | 6 | 251 | 1.0E-23 |
sp|O86034|BDHA_RHIME | D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 | 9 | 251 | 1.0E-23 |
sp|H9BFQ2|TPRL3_ERYCB | Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 | 1 | 250 | 2.0E-23 |
sp|Q4A054|Y0419_STAS1 | Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 | 6 | 197 | 2.0E-23 |
sp|P52037|YGFF_ECOLI | Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 | 10 | 250 | 2.0E-23 |
sp|P23238|PHBB_ZOORA | Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 | 9 | 250 | 3.0E-23 |
sp|Q9LHT0|TRNHF_ARATH | Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 | 5 | 253 | 4.0E-23 |
sp|P9WGS7|Y0687_MYCTU | Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 | 5 | 245 | 4.0E-23 |
sp|P9WGS6|Y0687_MYCTO | Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 | 5 | 245 | 4.0E-23 |
sp|Q9ZW15|TRNH9_ARATH | Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 | 5 | 253 | 4.0E-23 |
sp|Q8WNV7|DHRS4_PIG | Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 | 6 | 250 | 4.0E-23 |
sp|Q56840|HCDR_XANP2 | 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 | 9 | 251 | 4.0E-23 |
sp|Q9ZW03|TRNH3_ARATH | Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 | 5 | 250 | 4.0E-23 |
sp|G3YG17|LXRA_ASPNA | L-xylulose reductase OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=lxrA PE=1 SV=1 | 3 | 251 | 5.0E-23 |
sp|Q9ZW20|TRNHD_ARATH | Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 | 5 | 253 | 5.0E-23 |
sp|P72332|NODG_RHIS3 | Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 | 6 | 253 | 5.0E-23 |
sp|Q9RPT1|RHLG_PSEAE | Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 | 5 | 251 | 6.0E-23 |
sp|F1SWA0|ZERSY_ZINZE | Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 | 6 | 253 | 7.0E-23 |
sp|Q8JZV9|BDH2_MOUSE | 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 | 6 | 251 | 7.0E-23 |
sp|P50163|TRN2_DATST | Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 | 5 | 252 | 9.0E-23 |
sp|Q92506|DHB8_HUMAN | Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 | 1 | 251 | 9.0E-23 |
sp|Q42182|TRNH7_ARATH | Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 | 5 | 253 | 1.0E-22 |
sp|Q9Z8P2|FABG_CHLPN | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 | 5 | 251 | 1.0E-22 |
sp|Q89AG9|FABG_BUCBP | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 | 7 | 253 | 1.0E-22 |
sp|Q9ZW13|TRNH6_ARATH | Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 | 5 | 253 | 1.0E-22 |
sp|Q7FAE1|MOMAS_ORYSJ | Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 | 4 | 253 | 2.0E-22 |
sp|Q3KPT7|BDH2_XENLA | 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 | 6 | 251 | 2.0E-22 |
sp|P50205|PHBB_RHIME | Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 | 9 | 250 | 2.0E-22 |
sp|Q94KL7|SILD_FORIN | Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 | 4 | 253 | 3.0E-22 |
sp|P50164|TRN2_HYONI | Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 | 5 | 252 | 3.0E-22 |
sp|Q3T046|BDH2_BOVIN | 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 | 6 | 251 | 3.0E-22 |
sp|P9WGS5|Y2750_MYCTU | Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 | 1 | 252 | 4.0E-22 |
sp|P9WGS4|Y2750_MYCTO | Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 | 1 | 252 | 4.0E-22 |
sp|Q9URX0|YLX6_SCHPO | Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 | 5 | 252 | 5.0E-22 |
sp|Q9ZW19|TRNHC_ARATH | Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 | 5 | 253 | 5.0E-22 |
sp|H9BFQ0|TPRL1_ERYCB | Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 | 4 | 253 | 6.0E-22 |
sp|P16543|DHK2_STRVN | Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 | 1 | 250 | 6.0E-22 |
sp|O34782|YVRD_BACSU | Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 | 6 | 252 | 8.0E-22 |
sp|Q8SPU8|DHRS4_BOVIN | Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 | 6 | 250 | 8.0E-22 |
sp|Q9ZW16|TRNHA_ARATH | Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 | 5 | 253 | 8.0E-22 |
sp|Q9ZNN8|BUDC_CORGT | L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 | 9 | 252 | 8.0E-22 |
sp|P42556|PTR1_LEITA | Pteridine reductase 1 OS=Leishmania tarentolae GN=PTR1 PE=1 SV=1 | 3 | 251 | 9.0E-22 |
sp|Q73SC8|Y4146_MYCPA | Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 | 1 | 245 | 1.0E-21 |
sp|P50197|LINC_SPHPI | 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 | 6 | 251 | 2.0E-21 |
sp|Q8NUV9|Y2403_STAAW | Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 | 6 | 247 | 2.0E-21 |
sp|Q6G6J1|Y2370_STAAS | Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 | 6 | 247 | 2.0E-21 |
sp|Q9ZW18|SAG13_ARATH | Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 | 5 | 253 | 2.0E-21 |
sp|H9BFQ1|TPRL2_ERYCB | Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 | 4 | 253 | 2.0E-21 |
sp|O49332|TRNHE_ARATH | Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 | 5 | 253 | 2.0E-21 |
sp|A0R518|Y6031_MYCS2 | Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 | 8 | 242 | 3.0E-21 |
sp|O32229|YVAG_BACSU | Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 | 5 | 252 | 3.0E-21 |
sp|Q92GE0|FABG_RICCN | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 | 6 | 253 | 3.0E-21 |
sp|Q8KWS9|BACC_BACAM | Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 | 5 | 251 | 4.0E-21 |
sp|D4A1J4|BDH2_RAT | 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 | 6 | 251 | 5.0E-21 |
sp|P16544|ACT3_STRCO | Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 | 1 | 251 | 6.0E-21 |
sp|Q8RX32|TRNH2_ARATH | Tropinone reductase homolog At1g07450 OS=Arabidopsis thaliana GN=At1g07450 PE=2 SV=1 | 5 | 253 | 8.0E-21 |
sp|Q2FVD5|Y2778_STAA8 | Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 | 6 | 231 | 8.0E-21 |
sp|Q5HD73|Y2488_STAAC | Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 | 6 | 231 | 8.0E-21 |
sp|Q2FE21|Y2422_STAA3 | Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 | 6 | 231 | 8.0E-21 |
sp|C1C4R8|BDH2_LITCT | 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 | 6 | 251 | 9.0E-21 |
sp|Q5HLD8|Y2049_STAEQ | Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 | 9 | 197 | 1.0E-20 |
sp|Q8CN40|Y2036_STAES | Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 | 9 | 197 | 1.0E-20 |
sp|Q6CEE9|SDR_YARLI | Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 | 1 | 253 | 2.0E-20 |
sp|P0A9P9|IDNO_ECOLI | Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 | 5 | 253 | 2.0E-20 |
sp|P0A9Q0|IDNO_ECOL6 | Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 | 5 | 253 | 2.0E-20 |
sp|Q561X9|BDH2_DANRE | 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 | 6 | 251 | 3.0E-20 |
sp|Q5FPE5|GMDH_GLUOX | Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 | 6 | 253 | 3.0E-20 |
sp|Q1RKB7|FABG_RICBR | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 | 81 | 253 | 3.0E-20 |
sp|Q4UK62|FABG_RICFE | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 | 44 | 253 | 3.0E-20 |
sp|P87219|SOU1_CANAL | Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 | 5 | 253 | 5.0E-20 |
sp|Q9S9W2|SDRA_ARATH | Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 | 4 | 251 | 5.0E-20 |
sp|Q8VID1|DHRS4_RAT | Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 | 6 | 250 | 5.0E-20 |
sp|P9WGT3|FABG_MYCTU | 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 | 12 | 251 | 5.0E-20 |
sp|P9WGT2|FABG_MYCTO | 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 | 12 | 251 | 5.0E-20 |
sp|P0A5Y5|FABG_MYCBO | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 | 12 | 251 | 5.0E-20 |
sp|P06234|NODG_RHIME | Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 | 5 | 253 | 6.0E-20 |
sp|Q99LB2|DHRS4_MOUSE | Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 | 6 | 250 | 6.0E-20 |
sp|P70720|FABG_AGGAC | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 | 12 | 252 | 7.0E-20 |
sp|P19871|3BHD_COMTE | 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 | 3 | 248 | 8.0E-20 |
sp|Q99RF5|Y2478_STAAM | Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 | 6 | 231 | 8.0E-20 |
sp|Q7A3L9|Y2266_STAAN | Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 | 6 | 231 | 8.0E-20 |
sp|Q6MGB5|DHB8_RAT | Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 | 1 | 253 | 9.0E-20 |
sp|Q9Y6Z9|SOU1_SCHPO | Sorbose reductase sou1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sou1 PE=3 SV=1 | 5 | 252 | 2.0E-19 |
sp|Q9SCU0|SDR2A_ARATH | Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 | 4 | 250 | 2.0E-19 |
sp|Q9HK58|RHAD_THEAC | L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 | 8 | 253 | 2.0E-19 |
sp|P50842|KDUD_BACSU | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 | 5 | 252 | 3.0E-19 |
sp|Q4L8Y1|Y0585_STAHJ | Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 | 6 | 197 | 3.0E-19 |
sp|Q59787|DHSO_RHOSH | Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 | 6 | 250 | 3.0E-19 |
sp|Q9GKX2|DHRS4_RABIT | Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 | 6 | 250 | 4.0E-19 |
sp|P14697|PHBB_CUPNH | Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 | 6 | 251 | 4.0E-19 |
sp|O34308|YTKK_BACSU | Putative oxidoreductase YtkK OS=Bacillus subtilis (strain 168) GN=ytkK PE=3 SV=1 | 11 | 253 | 4.0E-19 |
sp|Q9BUT1|BDH2_HUMAN | 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 | 6 | 251 | 4.0E-19 |
sp|P0CG22|DR4L1_HUMAN | Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 | 6 | 250 | 4.0E-19 |
sp|Q6GDV6|Y2567_STAAR | Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 | 6 | 231 | 5.0E-19 |
sp|Q5RCH8|PECR_PONAB | Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 | 6 | 250 | 5.0E-19 |
sp|P42317|YXJF_BACSU | Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 | 9 | 251 | 6.0E-19 |
sp|Q9MYP6|DHB14_BOVIN | 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 | 8 | 250 | 6.0E-19 |
sp|Q9ZW12|TRNH5_ARATH | Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 | 5 | 253 | 7.0E-19 |
sp|Q937L4|CPNA_COMTE | Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 | 9 | 251 | 9.0E-19 |
sp|Q8GAV9|CPNA_COMS9 | Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 | 9 | 251 | 9.0E-19 |
sp|P45375|PHBB_ALLVD | Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 | 9 | 253 | 1.0E-18 |
sp|P50171|DHB8_MOUSE | Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus GN=Hsd17b8 PE=1 SV=2 | 1 | 253 | 1.0E-18 |
sp|P76633|YGCW_ECOLI | Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 | 5 | 253 | 1.0E-18 |
sp|P66782|Y1385_MYCBO | Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 | 6 | 250 | 2.0E-18 |
sp|P9WGR9|Y1350_MYCTU | Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 | 6 | 250 | 2.0E-18 |
sp|P9WGR8|Y1350_MYCTO | Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 | 6 | 250 | 2.0E-18 |
sp|Q21929|DCXR_CAEEL | L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 | 2 | 251 | 2.0E-18 |
sp|P50204|PHAB_PARDE | Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 | 9 | 250 | 2.0E-18 |
sp|Q04520|BUDC_RAOTE | Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 | 9 | 223 | 2.0E-18 |
sp|P0C0Y5|MTDH_DAVTA | Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 | 5 | 253 | 3.0E-18 |
sp|B8H1Z0|XDH_CAUCN | D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 | 5 | 251 | 3.0E-18 |
sp|Q5TJF5|DHB8_CANLF | Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 | 6 | 251 | 4.0E-18 |
sp|Q9WVK3|PECR_RAT | Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 | 1 | 250 | 4.0E-18 |
sp|O14351|YB45_SCHPO | Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 | 9 | 243 | 4.0E-18 |
sp|Q1JP75|DCXR_BOVIN | L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 | 6 | 252 | 5.0E-18 |
sp|Q9BY49|PECR_HUMAN | Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 | 6 | 250 | 6.0E-18 |
sp|P22441|DHMA_FLAS1 | N-acylmannosamine 1-dehydrogenase OS=Flavobacterium sp. (strain 141-8) PE=1 SV=3 | 6 | 251 | 8.0E-18 |
sp|P87218|SOU2_CANAL | Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 | 5 | 253 | 9.0E-18 |
sp|F4J2Z7|SDR4_ARATH | Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 | 4 | 253 | 1.0E-17 |
sp|P05707|SRLD_ECOLI | Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 | 9 | 253 | 1.0E-17 |
sp|P50200|HDHA_CLOSO | NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 | 4 | 251 | 1.0E-17 |
sp|F4J300|SDR5_ARATH | Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 | 1 | 253 | 1.0E-17 |
sp|P71534|FABG_MYCS2 | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 | 12 | 251 | 1.0E-17 |
sp|P55575|Y4MP_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 | 6 | 253 | 2.0E-17 |
sp|P07914|BAIA1_CLOSV | Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 | 9 | 251 | 2.0E-17 |
sp|P0C622|CMTB_PSEPU | 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 | 6 | 250 | 2.0E-17 |
sp|A5W4G5|CMTB_PSEP1 | 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 | 6 | 250 | 2.0E-17 |
sp|O80713|SDR3A_ARATH | Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 | 1 | 253 | 3.0E-17 |
sp|Q6P0H7|CBR4_DANRE | Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 | 9 | 251 | 4.0E-17 |
sp|Q05069|FABI_NOSS1 | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fabI PE=3 SV=2 | 5 | 253 | 4.0E-17 |
sp|P25145|Y432_LISMO | Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 | 5 | 231 | 7.0E-17 |
sp|Q92RN6|GALD_RHIME | Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 | 6 | 250 | 7.0E-17 |
sp|P00335|RIDH_ENTAE | Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 | 5 | 198 | 8.0E-17 |
sp|P50160|TS2_MAIZE | Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 | 4 | 250 | 9.0E-17 |
sp|Q01782|PTR1_LEIMA | Pteridine reductase 1 OS=Leishmania major GN=PTR1 PE=1 SV=2 | 10 | 251 | 9.0E-17 |
sp|Q8P3K4|FUCDH_XANCP | 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 | 86 | 251 | 9.0E-17 |
sp|Q9RA05|LIMC_RHOER | (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 | 8 | 250 | 1.0E-16 |
sp|P19337|BAIA2_CLOSV | Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 | 9 | 251 | 1.0E-16 |
sp|Q92EK7|Y452_LISIN | Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 | 5 | 231 | 2.0E-16 |
sp|Q5C9I9|ISPD_MENPI | (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 | 4 | 251 | 2.0E-16 |
sp|P0C0Y4|MTDH_ALTAL | Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 | 5 | 253 | 3.0E-16 |
sp|P16542|DHK1_STRVN | Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 | 10 | 232 | 3.0E-16 |
sp|P9WGT1|HSD_MYCTU | 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 | 6 | 252 | 3.0E-16 |
sp|P69166|HSD_MYCBO | 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 | 6 | 252 | 3.0E-16 |
sp|Q53217|Y4VI_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 | 8 | 252 | 4.0E-16 |
sp|P9WGT0|HSD_MYCTO | 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 | 6 | 252 | 5.0E-16 |
sp|Q8K9J5|FABG_BUCAP | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 | 9 | 253 | 6.0E-16 |
sp|A3LZU7|RM1DH_PICST | L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 | 3 | 253 | 7.0E-16 |
sp|P44432|FABI_HAEIN | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabI PE=3 SV=3 | 6 | 253 | 7.0E-16 |
sp|Q920P0|DCXR_RAT | L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 | 6 | 252 | 8.0E-16 |
sp|O42866|FABG_SCHPO | 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 | 12 | 251 | 1.0E-15 |
sp|P73016|FABI_SYNY3 | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabI PE=3 SV=2 | 6 | 253 | 1.0E-15 |
sp|P58381|FABI2_RHIME | Enoyl-[acyl-carrier-protein] reductase [NADH] 2 OS=Rhizobium meliloti (strain 1021) GN=fabI2 PE=3 SV=1 | 6 | 251 | 1.0E-15 |
sp|P73826|FABG2_SYNY3 | 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 | 1 | 249 | 1.0E-15 |
sp|P50167|ARDH_PICST | D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 | 6 | 251 | 1.0E-15 |
sp|Q91XV4|DCXR_MESAU | L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 | 6 | 253 | 1.0E-15 |
sp|Q91VT4|CBR4_MOUSE | Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 | 9 | 251 | 1.0E-15 |
sp|P43066|ARDH_CANAW | D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 | 6 | 251 | 2.0E-15 |
sp|Q51576|Y3106_PSEAE | Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 | 7 | 251 | 2.0E-15 |
sp|Q9LBG2|LVR_LEIAQ | Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 | 3 | 250 | 2.0E-15 |
sp|Q56318|Y019_THEMA | Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 | 6 | 253 | 2.0E-15 |
sp|Q9XT00|DHB8_PIG | Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN=HSD17B8 PE=3 SV=2 | 1 | 253 | 2.0E-15 |
sp|P0A169|NAHB_PSEPU | 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas putida GN=nahB PE=3 SV=1 | 9 | 253 | 3.0E-15 |
sp|Q46381|BPHB_COMTE | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 | 6 | 197 | 3.0E-15 |
sp|P0A170|NAHB_PSEU8 | 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxE PE=3 SV=1 | 9 | 253 | 3.0E-15 |
sp|P50166|ARDH_CANTR | D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 | 6 | 251 | 3.0E-15 |
sp|Q91X52|DCXR_MOUSE | L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 | 6 | 252 | 5.0E-15 |
sp|O07399|FABG_MYCAV | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 | 12 | 251 | 6.0E-15 |
sp|O80714|SDR3C_ARATH | Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 | 1 | 253 | 6.0E-15 |
sp|Q9BPX1|DHB14_HUMAN | 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 | 52 | 250 | 7.0E-15 |
sp|P22414|FOX2_CANTR | Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 | 3 | 252 | 7.0E-15 |
sp|Q01373|FOX2_NEUCR | Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 | 6 | 234 | 7.0E-15 |
sp|P57432|FABG_BUCAI | 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 | 9 | 253 | 8.0E-15 |
sp|O00058|MTDH_UROFA | Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 | 3 | 253 | 9.0E-15 |
sp|Q7Z9I4|YCP6_SCHPO | Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 | 5 | 195 | 1.0E-14 |
sp|Q94KL8|SILD_PODPE | Secoisolariciresinol dehydrogenase (Fragment) OS=Podophyllum peltatum PE=1 SV=1 | 64 | 251 | 1.0E-14 |
sp|Q8KES3|SPRE_CHLTE | Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 | 9 | 250 | 2.0E-14 |
sp|O34717|FADH_BACSU | Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis (strain 168) GN=fadH PE=2 SV=1 | 9 | 250 | 2.0E-14 |
sp|Q8NK50|MTDH_HYPJE | NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 | 5 | 251 | 2.0E-14 |
sp|D2WKD9|SDR1_AEDAE | Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 | 8 | 208 | 3.0E-14 |
sp|O67505|FABI_AQUAE | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Aquifex aeolicus (strain VF5) GN=fabI PE=1 SV=2 | 6 | 251 | 3.0E-14 |
sp|O13908|YF3H_SCHPO | Uncharacterized oxidoreductase C22A12.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.17c PE=3 SV=1 | 5 | 251 | 4.0E-14 |
sp|Q6PKH6|DR4L2_HUMAN | Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 | 6 | 188 | 5.0E-14 |
sp|P31808|YCIK_ECOLI | Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 | 6 | 252 | 6.0E-14 |
sp|Q81GI3|FABI_BACCR | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fabI PE=1 SV=1 | 6 | 251 | 6.0E-14 |
sp|Q99MZ7|PECR_MOUSE | Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus GN=Pecr PE=1 SV=1 | 1 | 250 | 6.0E-14 |
sp|Q7TS56|CBR4_RAT | Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 | 9 | 251 | 6.0E-14 |
sp|P51660|DHB4_MOUSE | Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 | 6 | 251 | 6.0E-14 |
sp|P72220|BPHB_PSEPU | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 | 6 | 253 | 7.0E-14 |
sp|Q94K41|SDR3B_ARATH | Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 | 1 | 253 | 7.0E-14 |
sp|P9WGQ5|Y927C_MYCTU | Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 | 6 | 251 | 8.0E-14 |
sp|P9WGQ4|Y927C_MYCTO | Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 | 6 | 251 | 8.0E-14 |
sp|P23102|XYLL_PSEPU | 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 | 4 | 250 | 1.0E-13 |
sp|Q8VCC1|PGDH_MOUSE | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 | 6 | 231 | 1.0E-13 |
sp|P51659|DHB4_HUMAN | Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 | 6 | 251 | 2.0E-13 |
sp|Q8N4T8|CBR4_HUMAN | Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 | 9 | 251 | 2.0E-13 |
sp|Q9M1K9|ATA1_ARATH | Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 | 4 | 251 | 3.0E-13 |
sp|P97852|DHB4_RAT | Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 | 6 | 251 | 3.0E-13 |
sp|O32291|YXNA_BACSU | Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 | 9 | 234 | 3.0E-13 |
sp|P37079|SORD_KLEPN | Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 | 5 | 250 | 4.0E-13 |
sp|Q9STY8|HSD2_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 | 1 | 197 | 4.0E-13 |
sp|Q9LUE4|HSD6_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 | 1 | 199 | 4.0E-13 |
sp|Q02207|FOX2_YEAST | Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 | 5 | 232 | 5.0E-13 |
sp|Q3T0C2|PGDH_BOVIN | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 | 6 | 204 | 7.0E-13 |
sp|P08074|CBR2_MOUSE | Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 | 5 | 252 | 8.0E-13 |
sp|G5DGA8|IDLDH_IPSPI | Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 | 10 | 199 | 9.0E-13 |
sp|P39071|DHBA_BACSU | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 | 1 | 250 | 9.0E-13 |
sp|P50203|PHAB_ACISR | Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 | 9 | 253 | 1.0E-12 |
sp|P0DKC6|HSD1B_ARATH | 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 | 3 | 207 | 1.0E-12 |
sp|P0DKC5|HSD1A_ARATH | 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 | 3 | 207 | 1.0E-12 |
sp|Q920N9|DCXR_CAVPO | L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1 | 6 | 252 | 1.0E-12 |
sp|Q9STY7|HSD3_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 | 1 | 197 | 1.0E-12 |
sp|A4IFA7|CBR4_BOVIN | Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 | 9 | 251 | 1.0E-12 |
sp|O74470|YQC8_SCHPO | Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 | 5 | 253 | 2.0E-12 |
sp|Q53882|DNRE_STRS5 | Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 | 7 | 253 | 2.0E-12 |
sp|Q7Z4W1|DCXR_HUMAN | L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2 | 6 | 251 | 2.0E-12 |
sp|P40747|YUXG_BACSU | Uncharacterized oxidoreductase YuxG OS=Bacillus subtilis (strain 168) GN=yuxG PE=3 SV=2 | 5 | 250 | 2.0E-12 |
sp|Q9NUI1|DECR2_HUMAN | Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 | 6 | 250 | 2.0E-12 |
sp|Q8JIS3|DER_CHICK | D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1 | 5 | 253 | 2.0E-12 |
sp|P50206|BPHB_PSES1 | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 | 6 | 197 | 3.0E-12 |
sp|Q29529|CBR2_PIG | Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 | 5 | 252 | 3.0E-12 |
sp|Q9JIF5|PECR_CAVPO | Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 | 23 | 250 | 3.0E-12 |
sp|P80702|DIDH_COMTE | 3-alpha-hydroxysteroid dehydrogenase/carbonyl reductase OS=Comamonas testosteroni GN=hsdA PE=1 SV=2 | 10 | 251 | 3.0E-12 |
sp|P19992|HSD_STREX | 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 | 6 | 251 | 3.0E-12 |
sp|O52384|NAGB_RALSP | 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Ralstonia sp. GN=nagB PE=3 SV=2 | 9 | 253 | 3.0E-12 |
sp|P37694|HETN_NOSS1 | Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 | 5 | 194 | 4.0E-12 |
sp|Q6F7B8|ACR1_ACIAD | Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 | 4 | 197 | 5.0E-12 |
sp|P47227|BPHB_BURXL | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 | 6 | 197 | 5.0E-12 |
sp|Q5RBV3|DECR2_PONAB | Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 | 6 | 250 | 6.0E-12 |
sp|Q8MJY8|PGDH_MACFA | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 | 6 | 231 | 6.0E-12 |
sp|P15428|PGDH_HUMAN | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 | 6 | 231 | 7.0E-12 |
sp|Q9LUF2|HSD4B_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 | 3 | 194 | 8.0E-12 |
sp|P0DKC7|HSD4A_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 | 3 | 194 | 8.0E-12 |
sp|P55435|Y4EL_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4eL OS=Rhizobium sp. (strain NGR234) GN=NGR_a03830 PE=3 SV=1 | 10 | 252 | 8.0E-12 |
sp|Q6NV34|DECR2_DANRE | Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 | 6 | 250 | 8.0E-12 |
sp|P06235|NODG_RHIML | Nodulation protein G OS=Rhizobium meliloti GN=nodG PE=3 SV=1 | 6 | 253 | 9.0E-12 |
sp|P05406|FIXR_BRADU | Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 | 9 | 250 | 9.0E-12 |
sp|P9WGR5|Y484_MYCTU | Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 | 1 | 234 | 1.0E-11 |
sp|P9WGR4|Y484_MYCTO | Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 | 1 | 234 | 1.0E-11 |
sp|Q9VXJ0|DHB4_DROME | Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 | 8 | 252 | 1.0E-11 |
sp|P07772|BEND_ACIAD | 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 | 2 | 250 | 1.0E-11 |
sp|P32573|SPS19_YEAST | Peroxisomal 2,4-dienoyl-CoA reductase SPS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS19 PE=1 SV=4 | 6 | 250 | 1.0E-11 |
sp|Q7Z9I2|YCP9_SCHPO | Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 | 1 | 227 | 2.0E-11 |
sp|P58380|FABI1_RHIME | Enoyl-[acyl-carrier-protein] reductase [NADH] 1 OS=Rhizobium meliloti (strain 1021) GN=fabI1 PE=3 SV=1 | 2 | 251 | 2.0E-11 |
sp|Q22230|DECR_CAEEL | Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 | 5 | 250 | 2.0E-11 |
sp|Q56841|HCDS_XANP2 | 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 | 6 | 251 | 2.0E-11 |
sp|Q9LTV6|DECR2_ARATH | Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana GN=At3g12800 PE=2 SV=1 | 8 | 251 | 3.0E-11 |
sp|Q5F389|WWOX_CHICK | WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 | 4 | 191 | 3.0E-11 |
sp|P54554|YQJQ_BACSU | Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 | 4 | 198 | 4.0E-11 |
sp|P70684|PGDH_CAVPO | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 | 6 | 204 | 4.0E-11 |
sp|Q6NUE2|CBR4_XENLA | Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 | 9 | 251 | 5.0E-11 |
sp|Q9ZFE4|FABI_PSEAE | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabI PE=1 SV=1 | 6 | 251 | 5.0E-11 |
sp|Q9P7I6|YJNK_SCHPO | Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 | 8 | 211 | 7.0E-11 |
sp|Q7Z9I3|YCP8_SCHPO | Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 | 5 | 195 | 8.0E-11 |
sp|O18404|HCD2_DROME | 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 | 10 | 251 | 1.0E-10 |
sp|P54616|FABI_BACSU | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Bacillus subtilis (strain 168) GN=fabI PE=1 SV=2 | 5 | 253 | 1.0E-10 |
sp|P55434|Y4EK_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 | 9 | 199 | 1.0E-10 |
sp|Q64591|DECR_RAT | 2,4-dienoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Decr1 PE=1 SV=2 | 4 | 250 | 1.0E-10 |
sp|Q49WS9|Y1627_STAS1 | Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 | 9 | 197 | 1.0E-10 |
sp|O08699|PGDH_RAT | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 | 6 | 231 | 2.0E-10 |
sp|P16657|FABI_SALTY | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabI PE=1 SV=3 | 6 | 253 | 2.0E-10 |
sp|P13859|TODD_PSEP1 | Cis-toluene dihydrodiol dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todD PE=1 SV=1 | 6 | 253 | 3.0E-10 |
sp|P08088|BNZE_PSEPU | Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Pseudomonas putida GN=bnzE PE=3 SV=2 | 6 | 253 | 3.0E-10 |
sp|O93868|MTDH_AGABI | NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 | 3 | 253 | 3.0E-10 |
sp|Q9NKW1|MFEA_DICDI | Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 | 9 | 233 | 3.0E-10 |
sp|P0AEK6|FABI_SHIFL | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Shigella flexneri GN=fabI PE=3 SV=2 | 6 | 253 | 3.0E-10 |
sp|P0AEK4|FABI_ECOLI | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Escherichia coli (strain K12) GN=fabI PE=1 SV=2 | 6 | 253 | 3.0E-10 |
sp|P0AEK5|FABI_ECO57 | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Escherichia coli O157:H7 GN=fabI PE=3 SV=2 | 6 | 253 | 3.0E-10 |
sp|Q01373|FOX2_NEUCR | Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 | 28 | 190 | 4.0E-10 |
sp|Q9Y394|DHRS7_HUMAN | Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 | 6 | 195 | 4.0E-10 |
sp|Q99714|HCD2_HUMAN | 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 | 2 | 249 | 5.0E-10 |
sp|Q9CXR1|DHRS7_MOUSE | Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 | 6 | 222 | 5.0E-10 |
sp|Q9CQ62|DECR_MOUSE | 2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Decr1 PE=1 SV=1 | 5 | 250 | 6.0E-10 |
sp|P08694|BPHB_PSEPS | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas pseudoalcaligenes GN=bphB PE=3 SV=2 | 6 | 197 | 9.0E-10 |
sp|Q9SY73|PTALR_ARATH | NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 | 9 | 198 | 9.0E-10 |
sp|Q93761|YXEK_CAEEL | Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans GN=F53C11.3 PE=3 SV=1 | 5 | 250 | 9.0E-10 |
sp|Q05016|YM71_YEAST | NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 | 2 | 234 | 1.0E-09 |
sp|O02691|HCD2_BOVIN | 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 | 2 | 249 | 1.0E-09 |
sp|Q5R9W5|WWOX_PONAB | WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 | 4 | 191 | 1.0E-09 |
sp|O32185|YUSS_BACSU | Short-chain dehydrogenase/reductase homolog YusS OS=Bacillus subtilis (strain 168) GN=yusS PE=5 SV=1 | 9 | 107 | 1.0E-09 |
sp|O70351|HCD2_RAT | 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 | 2 | 249 | 1.0E-09 |
sp|P47230|BPHB_RHOGO | Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 | 6 | 250 | 2.0E-09 |
sp|Q9NZC7|WWOX_HUMAN | WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 | 4 | 191 | 2.0E-09 |
sp|Q23116|YWC4_CAEEL | Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 | 5 | 250 | 2.0E-09 |
sp|P40579|YIV5_YEAST | Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR035C PE=1 SV=1 | 8 | 197 | 2.0E-09 |
sp|Q9HBH5|RDH14_HUMAN | Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 | 6 | 199 | 3.0E-09 |
sp|P22414|FOX2_CANTR | Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 | 1 | 251 | 4.0E-09 |
sp|Q9GME3|DHB8_CALJA | Estradiol 17-beta-dehydrogenase 8 (Fragment) OS=Callithrix jacchus GN=HSD17B8 PE=2 SV=1 | 160 | 242 | 4.0E-09 |
sp|Q8T197|DHRS7_DICDI | Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 | 5 | 197 | 4.0E-09 |
sp|P37959|YUSZ_BACSU | Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 | 6 | 198 | 5.0E-09 |
sp|Q9Z2M4|DECR2_RAT | Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 | 6 | 250 | 5.0E-09 |
sp|G0RH19|LXR3_HYPJQ | L-xylulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr3 PE=1 SV=1 | 5 | 251 | 6.0E-09 |
sp|Q9K151|FABI_NEIMB | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Neisseria meningitidis serogroup B (strain MC58) GN=fabI PE=1 SV=1 | 6 | 253 | 7.0E-09 |
sp|O74959|YJCD_SCHPO | Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 | 6 | 212 | 8.0E-09 |
sp|Q91WL8|WWOX_MOUSE | WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 | 4 | 191 | 8.0E-09 |
sp|P96825|Y0148_MYCTU | Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 | 9 | 234 | 9.0E-09 |
sp|Q7T2D1|RD10B_DANRE | Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 | 4 | 202 | 1.0E-08 |
sp|Q9T0G0|HSD5_ARATH | 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 | 1 | 187 | 1.0E-08 |
sp|P15047|ENTA_ECOLI | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 | 6 | 250 | 1.0E-08 |
sp|E3VWK2|PENF_STREX | 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 | 6 | 197 | 1.0E-08 |
sp|Q566S6|DRS7B_DANRE | Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 | 9 | 197 | 1.0E-08 |
sp|A5PJJ7|S16C6_BOVIN | Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 | 7 | 199 | 2.0E-08 |
sp|Q4WZ66|CHADH_ASPFU | Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 | 5 | 245 | 2.0E-08 |
sp|D3J0Z1|CHADH_ASPFM | Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 | 5 | 245 | 2.0E-08 |
sp|O75828|CBR3_HUMAN | Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 | 5 | 197 | 2.0E-08 |
sp|Q6GI75|FABI_STAAR | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI OS=Staphylococcus aureus (strain MRSA252) GN=fabI PE=1 SV=1 | 5 | 251 | 3.0E-08 |
sp|P54795|MOAE_ENTAE | Protein MoaE OS=Enterobacter aerogenes GN=moaE PE=3 SV=1 | 118 | 250 | 3.0E-08 |
sp|Q68ER2|CBR4_XENTR | Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 | 9 | 251 | 3.0E-08 |
sp|O34896|UXUB_BACSU | Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 | 4 | 252 | 3.0E-08 |
sp|P27582|FABG6_BRANA | 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) OS=Brassica napus PE=1 SV=3 | 76 | 253 | 4.0E-08 |
sp|Q9ERI6|RDH14_MOUSE | Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 | 6 | 199 | 4.0E-08 |
sp|Q4ULZ7|FABI_RICFE | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabI PE=3 SV=1 | 1 | 243 | 4.0E-08 |
sp|Q1RH28|FABI_RICBR | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Rickettsia bellii (strain RML369-C) GN=fabI PE=3 SV=1 | 1 | 243 | 4.0E-08 |
sp|Q9KWN1|SDH_RHIRD | Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 | 12 | 234 | 6.0E-08 |
sp|Q16698|DECR_HUMAN | 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=DECR1 PE=1 SV=1 | 5 | 250 | 8.0E-08 |
sp|Q9Y140|DHRS7_DROME | Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 | 6 | 197 | 1.0E-07 |
sp|Q8N3Y7|RDHE2_HUMAN | Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 | 4 | 199 | 1.0E-07 |
sp|P45200|Y1430_HAEIN | Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 | 11 | 232 | 1.0E-07 |
sp|Q8NBN7|RDH13_HUMAN | Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 | 5 | 199 | 1.0E-07 |
sp|P9WGS3|EPHD_MYCTU | Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 | 13 | 195 | 1.0E-07 |
sp|P9WGS2|EPHD_MYCTO | Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 | 13 | 195 | 1.0E-07 |
sp|P66778|EPHD_MYCBO | Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 | 13 | 195 | 1.0E-07 |
sp|Q53217|Y4VI_RHISN | Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 | 9 | 252 | 2.0E-07 |
sp|Q9P324|YI78_SCHPO | Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 | 62 | 253 | 2.0E-07 |
sp|Q9EQ06|DHB11_MOUSE | Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 | 4 | 226 | 2.0E-07 |
sp|Q6AYS8|DHB11_RAT | Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 | 4 | 226 | 2.0E-07 |
sp|Q2FZQ3|FABI_STAA8 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI OS=Staphylococcus aureus (strain NCTC 8325) GN=fabI PE=1 SV=1 | 5 | 251 | 2.0E-07 |
sp|Q9P7B4|YI13_SCHPO | NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 | 6 | 231 | 2.0E-07 |
sp|Q96NR8|RDH12_HUMAN | Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 | 6 | 199 | 2.0E-07 |
sp|A1L1W4|RD10A_DANRE | Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 | 4 | 208 | 2.0E-07 |
sp|P39644|YWFH_BACSU | Bacilysin biosynthesis oxidoreductase YwfH OS=Bacillus subtilis (strain 168) GN=ywfH PE=1 SV=1 | 6 | 250 | 3.0E-07 |
sp|Q68X10|FABI_RICTY | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabI PE=3 SV=1 | 1 | 195 | 3.0E-07 |
sp|O74628|YQ53_SCHPO | Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 | 7 | 215 | 3.0E-07 |
sp|Q82IY9|PTLF_STRAW | 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 | 6 | 199 | 5.0E-07 |
sp|P69936|YDFG_SALTY | NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 | 10 | 234 | 6.0E-07 |
sp|P69935|YDFG_SALTI | NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 | 10 | 234 | 6.0E-07 |
sp|Q96LJ7|DHRS1_HUMAN | Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 | 6 | 213 | 6.0E-07 |
sp|Q17QU7|DHR13_BOVIN | Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 | 5 | 198 | 8.0E-07 |
sp|Q6UWP2|DHR11_HUMAN | Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 | 9 | 247 | 9.0E-07 |
sp|Q9WV68|DECR2_MOUSE | Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 | 6 | 250 | 9.0E-07 |
sp|Q99L04|DHRS1_MOUSE | Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 | 6 | 216 | 1.0E-06 |
sp|P59837|RDH12_BOVIN | Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 | 6 | 199 | 1.0E-06 |
sp|Q8N5I4|DHRSX_HUMAN | Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 | 9 | 199 | 1.0E-06 |
sp|Q92IC6|FABI_RICCN | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabI PE=3 SV=1 | 1 | 243 | 1.0E-06 |
sp|Q6RVV4|TIC32_PEA | Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 | 7 | 199 | 1.0E-06 |
sp|Q8CEE7|RDH13_MOUSE | Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 | 5 | 199 | 1.0E-06 |
sp|Q9ZMN7|FABI_HELPJ | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fabI PE=3 SV=1 | 6 | 195 | 1.0E-06 |
sp|P42829|INHA_MYCS2 | Enoyl-[acyl-carrier-protein] reductase [NADH] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=inhA PE=3 SV=1 | 3 | 195 | 1.0E-06 |
sp|Q7TQA3|RDHE2_MOUSE | Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 | 4 | 199 | 2.0E-06 |
sp|Q8TC12|RDH11_HUMAN | Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 | 2 | 199 | 2.0E-06 |
sp|D4AK45|CHADH_ARTBC | Chanoclavine-I dehydrogenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04646 PE=1 SV=1 | 5 | 245 | 2.0E-06 |
sp|Q0WRJ2|TC10A_ARATH | 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 | 6 | 204 | 2.0E-06 |
sp|Q0VFE7|DRS7B_XENTR | Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 | 6 | 197 | 2.0E-06 |
sp|A4W9Z4|FOLM_ENT38 | Dihydromonapterin reductase OS=Enterobacter sp. (strain 638) GN=folM PE=3 SV=1 | 12 | 190 | 2.0E-06 |
sp|O24990|FABI_HELPY | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fabI PE=1 SV=1 | 6 | 195 | 3.0E-06 |
sp|Q0IH28|DRS7B_XENLA | Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 | 6 | 197 | 3.0E-06 |
sp|Q5SS80|DHR13_MOUSE | Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 | 5 | 198 | 3.0E-06 |
sp|Q3U0B3|DHR11_MOUSE | Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 | 9 | 234 | 3.0E-06 |
sp|Q71R50|DHR11_CHICK | Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 | 4 | 195 | 3.0E-06 |
sp|Q8BYK4|RDH12_MOUSE | Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 | 8 | 199 | 3.0E-06 |
sp|Q5ZJG8|HSDL1_CHICK | Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 | 8 | 197 | 3.0E-06 |
sp|P35320|OXIR_STRLI | Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 | 6 | 98 | 3.0E-06 |
sp|Q7Q732|DHRS7_ANOGA | Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 | 4 | 197 | 4.0E-06 |
sp|Q6UX07|DHR13_HUMAN | Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 | 5 | 198 | 4.0E-06 |
sp|Q1QU27|ISFD2_CHRSD | Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 | 67 | 234 | 5.0E-06 |
sp|A4FUZ6|HSDL2_BOVIN | Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 | 3 | 133 | 5.0E-06 |
sp|F4JZN6|TC10B_ARATH | 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 | 13 | 199 | 5.0E-06 |
sp|Q071N0|SALR_PAPSO | Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 | 9 | 105 | 5.0E-06 |
sp|P9WGQ3|Y1714_MYCTU | Uncharacterized oxidoreductase Rv1714 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1714 PE=3 SV=1 | 1 | 251 | 6.0E-06 |
sp|P9WGQ2|Y1714_MYCTO | Uncharacterized oxidoreductase MT1753.1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1753.1 PE=3 SV=1 | 1 | 251 | 6.0E-06 |
sp|Q8NBQ5|DHB11_HUMAN | Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 | 4 | 195 | 7.0E-06 |
sp|P40580|BZRD_YEAST | Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 | 8 | 197 | 7.0E-06 |
sp|A5PJF6|HSDL1_BOVIN | Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 | 8 | 195 | 7.0E-06 |
sp|B2X050|MNR1_CAPAN | (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 | 1 | 106 | 7.0E-06 |
sp|Q28IU1|DHB12_XENTR | Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 | 8 | 203 | 7.0E-06 |
sp|Q2TPA8|HSDL2_MOUSE | Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 | 3 | 190 | 7.0E-06 |
sp|Q9ZDG4|FABI_RICPR | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Rickettsia prowazekii (strain Madrid E) GN=fabI PE=3 SV=1 | 1 | 195 | 8.0E-06 |
sp|Q6PUF3|DHI1L_DANRE | Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 | 4 | 195 | 8.0E-06 |
sp|Q8VCR2|DHB13_MOUSE | 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 | 4 | 195 | 9.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 33 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|103750 MATQSLTGKVAVVTGSSRSIGAAIAKALGAEGADVVVNYVNDAKAAKEVVDSIESEKKGKAIAIKADVSTVEGGK SLIDAVVQEWGRIDILVLNAGIMGSKVMADVDEQFFDSHFQTNVKAPFFTVQHAIPHITAPGGRLIFFSSSLTAS TTVLPNALCYVASKGAVEQMSRVLAKDLGSRGITVNTVSPGPVDTPLFRAGKPEAVIEMIKKQNPNQRLAVPNDI APIVAFVASPGAQWLTGQNIRPNGGFVV* |
Coding | >AgabiH97|103750 ATGGCCACTCAATCCCTCACTGGTAAAGTTGCTGTCGTGACTGGCTCTTCTCGTTCCATAGGTGCTGCTATCGCC AAAGCTCTGGGAGCAGAAGGTGCCGATGTCGTCGTCAACTACGTCAACGACGCAAAGGCTGCGAAAGAAGTCGTC GATTCCATTGAATCAGAGAAGAAGGGTAAAGCCATCGCTATCAAAGCCGATGTCTCAACCGTCGAGGGTGGTAAA TCGCTTATTGATGCTGTCGTTCAGGAGTGGGGAAGGATTGATATCCTCGTTTTGAATGCTGGTATAATGGGTAGT AAAGTTATGGCTGATGTCGATGAACAATTTTTCGATAGCCATTTCCAAACCAACGTCAAAGCACCCTTCTTTACT GTCCAGCATGCTATCCCTCATATAACTGCCCCTGGTGGCCGACTCATCTTCTTTTCCAGTAGTCTAACTGCATCT ACCACCGTCCTACCCAATGCCCTCTGTTATGTCGCCTCGAAGGGCGCCGTCGAACAGATGTCACGCGTTCTAGCG AAAGATCTGGGTTCTCGTGGGATCACCGTCAACACTGTCTCGCCAGGACCAGTAGATACGCCCCTGTTCCGTGCA GGTAAACCTGAAGCGGTGATTGAAATGATCAAAAAACAAAATCCAAACCAGCGTCTTGCCGTTCCTAATGATATT GCGCCGATTGTTGCTTTTGTTGCTAGTCCGGGTGCTCAGTGGCTCACTGGTCAAAATATCCGCCCGAATGGTGGT TTTGTCGTCTGA |
Transcript | >AgabiH97|103750 ATGGCCACTCAATCCCTCACTGGTAAAGTTGCTGTCGTGACTGGCTCTTCTCGTTCCATAGGTGCTGCTATCGCC AAAGCTCTGGGAGCAGAAGGTGCCGATGTCGTCGTCAACTACGTCAACGACGCAAAGGCTGCGAAAGAAGTCGTC GATTCCATTGAATCAGAGAAGAAGGGTAAAGCCATCGCTATCAAAGCCGATGTCTCAACCGTCGAGGGTGGTAAA TCGCTTATTGATGCTGTCGTTCAGGAGTGGGGAAGGATTGATATCCTCGTTTTGAATGCTGGTATAATGGGTAGT AAAGTTATGGCTGATGTCGATGAACAATTTTTCGATAGCCATTTCCAAACCAACGTCAAAGCACCCTTCTTTACT GTCCAGCATGCTATCCCTCATATAACTGCCCCTGGTGGCCGACTCATCTTCTTTTCCAGTAGTCTAACTGCATCT ACCACCGTCCTACCCAATGCCCTCTGTTATGTCGCCTCGAAGGGCGCCGTCGAACAGATGTCACGCGTTCTAGCG AAAGATCTGGGTTCTCGTGGGATCACCGTCAACACTGTCTCGCCAGGACCAGTAGATACGCCCCTGTTCCGTGCA GGTAAACCTGAAGCGGTGATTGAAATGATCAAAAAACAAAATCCAAACCAGCGTCTTGCCGTTCCTAATGATATT GCGCCGATTGTTGCTTTTGTTGCTAGTCCGGGTGCTCAGTGGCTCACTGGTCAAAATATCCGCCCGAATGGTGGT TTTGTCGTCTGA |
Gene | >AgabiH97|103750 ATGGCCACTCAATCCCTCACTGGTAAGTACACGCTTGTTGGAGGCTCCGATTGTTTGATAGCTCAGGTCAAATAA CCAGGTAAAGTTGCTGTCGTGACTGGCTCTTCTCGTTCCATAGGTGCTGCTATCGCCAAAGCTCTGGGAGCAGAA GGTGCCGATGTCGTCGTCAACTACGTCAACGACGCAAAGGCTGCGAAAGAAGTCGTCGATTCCATTGAATCAGAG AAGAAGGGTAAAGCCATCGCTATCAAAGCCGATGTCTCAACCGTCGAGGGTGGTAAATCGCTTATTGATGCTGTC GTTCAGGAGTGGGGAAGGATTGATATCCTCGTTTTGAATGCTGGTATAATGGGTAGTAAAGTTATGGCTGATGTC GATGAACAATTTTTCGATAGCCATTTCCAAACCAACGTCAAAGCACCCTTCTTTACTGTCCAGCATGCTATCCCT CATATAACTGCCCGTATGTTATCATCTCTCGCTGTTTGCAACTGTTTCTGATAATTTGTTTTAGCTGGTGGCCGA CTCATCTTCTTTTCCAGTAGTCTAACTGCATCTACCAGTACGTCACTCACGCGCATCACTGTCAGAAACCCCGAT CTTATTTTTAACCAGCCGTCCTACCCAATGCCCTCTGTTATGTCGCCTCGAAGGGCGCCGTCGAACAGATGTCAC GCGTTCTAGCGAAAGATCTGGGTTCTCGTGGGATCACCGTCAACACTGTCTCGCCAGGACCAGTAGATACGCCCC TGTTCCGTGCAGGTAAACCTGAAGCGGTGATTGAAATGATCAAAAAACAAAATCCAAACCAGCGTCTTGCCGTTC CTAATGATATTGCGCCGATTGTTGCTTTTGTTGCTAGTCCGGGTGCTCAGTGGCTCACTGGTCAAAATATCCGCC CGAATGGTGTAAGTTTTGTTTTTTTTCTTAGTTTTTTGTTGCTTTGGTACTGAGGATTGGTGTTTGATAGGGTTT TGTCGTCTGA |