Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103700
Gene name
Locationscaffold_7:1661934..1663280
Strand-
Gene length (bp)1346
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain 3.2E-57 22 243
PF00734 CBM_1 Fungal cellulose binding domain 2.8E-10 289 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 265 322 5.0E-10
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 250 322 4.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 289 322 7.0E-09
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 276 322 9.0E-09
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 268 322 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 265 322 5.0E-10
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 250 322 4.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 289 322 7.0E-09
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 276 322 9.0E-09
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 268 322 2.0E-08
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 284 322 4.0E-08
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 284 322 4.0E-08
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 281 321 6.0E-08
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 266 322 6.0E-08
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 278 321 7.0E-08
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 285 322 8.0E-08
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 261 322 1.0E-07
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 289 322 3.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 289 322 3.0E-07
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 289 322 3.0E-07
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 289 322 1.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 289 322 1.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 283 322 2.0E-06
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 285 322 2.0E-06
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 287 322 3.0E-06
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 289 322 4.0E-06
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 289 322 5.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 287 322 5.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 289 322 6.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 241 322 8.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 287 322 9.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 287 322 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 64.87 27.52 102.22
Initials Initials knots 3.13 1.14 5.12
Pileal_Stipeal_center Stage I stipe center 4.65 1.89 7.41
Pileal_Stipeal_shell Stage I stipe shell 4.82 1.95 7.69
DIF_stipe_center Stage II stipe center 4.72 1.92 7.52
DIF_stipe_shell Stage II stipe shell 3.11 1.08 5.14
DIF_stipe_skin Stage II stipe skin 3.66 1.39 5.94
DIF_cap_skin Stage II cap skin 4.29 1.71 6.87
DIF_cap_tissue Stage II cap tissue 4.05 1.58 6.53
DIF_gill_tissue Stage II gill tissue 4.65 1.89 7.41
YFB_stipe_center Young fruiting body stipe center 6.03 2.56 9.51
YFB_stipe_shell Young fruiting body stipe shell 4.12 1.63 6.61
YFB_stipe_skin Young fruiting body stipe skin 3.26 1.19 5.34
YFB_cap_skin Young fruiting body cap skin 5.62 2.35 8.89
YFB_cap_tissue Young fruiting body cap tissue 7.38 3.27 11.50
YFB_gill_tissue Young fruiting body gill tissue 5.68 2.39 8.96
YFB_veil Young fruiting body veil 4.53 1.80 7.25

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.645785 no
DIF_gill_tissue YFB_stipe_shell 0.865648 no
DIF_gill_tissue YFB_stipe_skin 0.527586 no
DIF_gill_tissue YFB_cap_skin 0.762523 no
DIF_gill_tissue YFB_cap_tissue 0.303559 no
DIF_gill_tissue YFB_gill_tissue 0.750694 no
DIF_gill_tissue YFB_veil 0.973865 no
YFB_stipe_center YFB_stipe_shell 0.437079 no
YFB_stipe_center YFB_stipe_skin 0.168812 no
YFB_stipe_center YFB_cap_skin 0.924556 no
YFB_stipe_center YFB_cap_tissue 0.724598 no
YFB_stipe_center YFB_gill_tissue 0.934810 no
YFB_stipe_center YFB_veil 0.588481 no
YFB_stipe_shell YFB_stipe_skin 0.721924 no
YFB_stipe_shell YFB_cap_skin 0.561313 no
YFB_stipe_shell YFB_cap_tissue 0.165674 no
YFB_stipe_shell YFB_gill_tissue 0.549910 no
YFB_stipe_shell YFB_veil 0.900938 no
YFB_stipe_skin YFB_cap_skin 0.239759 no
YFB_stipe_skin YFB_cap_tissue 0.047373 yes
YFB_stipe_skin YFB_gill_tissue 0.229368 no
YFB_stipe_skin YFB_veil 0.560202 no
YFB_cap_skin YFB_cap_tissue 0.601215 no
YFB_cap_skin YFB_gill_tissue 0.989685 no
YFB_cap_skin YFB_veil 0.714926 no
YFB_cap_tissue YFB_gill_tissue 0.624033 no
YFB_cap_tissue YFB_veil 0.259579 no
YFB_gill_tissue YFB_veil 0.697866 no
Initials DIF_gill_tissue 0.458582 no
Initials YFB_stipe_center 0.130110 no
Initials YFB_stipe_shell 0.648932 no
Initials YFB_stipe_skin 0.960706 no
Initials YFB_cap_skin 0.194728 no
Initials YFB_cap_tissue 0.031088 yes
Initials YFB_gill_tissue 0.183309 no
Initials YFB_veil 0.493477 no
Initials Pileal_Stipeal_center 0.457904 no
Initials Pileal_Stipeal_shell 0.393588 no
Initials DIF_stipe_center 0.432334 no
Initials DIF_stipe_shell 0.995933 no
Initials DIF_stipe_skin 0.825955 no
Initials DIF_cap_skin 0.587579 no
Initials DIF_cap_tissue 0.675895 no
Pileal_Stipeal_center DIF_gill_tissue 0.996937 no
Pileal_Stipeal_center YFB_stipe_center 0.646804 no
Pileal_Stipeal_center YFB_stipe_shell 0.866788 no
Pileal_Stipeal_center YFB_stipe_skin 0.529153 no
Pileal_Stipeal_center YFB_cap_skin 0.764628 no
Pileal_Stipeal_center YFB_cap_tissue 0.301751 no
Pileal_Stipeal_center YFB_gill_tissue 0.753513 no
Pileal_Stipeal_center YFB_veil 0.973691 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.966738 no
Pileal_Stipeal_center DIF_stipe_center 0.984879 no
Pileal_Stipeal_center DIF_stipe_shell 0.441846 no
Pileal_Stipeal_center DIF_stipe_skin 0.696119 no
Pileal_Stipeal_center DIF_cap_skin 0.918928 no
Pileal_Stipeal_center DIF_cap_tissue 0.849661 no
Pileal_Stipeal_shell DIF_gill_tissue 0.964918 no
Pileal_Stipeal_shell YFB_stipe_center 0.712108 no
Pileal_Stipeal_shell YFB_stipe_shell 0.819899 no
Pileal_Stipeal_shell YFB_stipe_skin 0.475905 no
Pileal_Stipeal_shell YFB_cap_skin 0.822381 no
Pileal_Stipeal_shell YFB_cap_tissue 0.358922 no
Pileal_Stipeal_shell YFB_gill_tissue 0.810148 no
Pileal_Stipeal_shell YFB_veil 0.937270 no
Pileal_Stipeal_shell DIF_stipe_center 0.980955 no
Pileal_Stipeal_shell DIF_stipe_shell 0.392355 no
Pileal_Stipeal_shell DIF_stipe_skin 0.639246 no
Pileal_Stipeal_shell DIF_cap_skin 0.877021 no
Pileal_Stipeal_shell DIF_cap_tissue 0.800882 no
DIF_stipe_center DIF_gill_tissue 0.984774 no
DIF_stipe_center YFB_stipe_center 0.674137 no
DIF_stipe_center YFB_stipe_shell 0.842073 no
DIF_stipe_center YFB_stipe_skin 0.504520 no
DIF_stipe_center YFB_cap_skin 0.785863 no
DIF_stipe_center YFB_cap_tissue 0.322072 no
DIF_stipe_center YFB_gill_tissue 0.773420 no
DIF_stipe_center YFB_veil 0.958438 no
DIF_stipe_center DIF_stipe_shell 0.417184 no
DIF_stipe_center DIF_stipe_skin 0.669632 no
DIF_stipe_center DIF_cap_skin 0.898778 no
DIF_stipe_center DIF_cap_tissue 0.823692 no
DIF_stipe_shell DIF_gill_tissue 0.447555 no
DIF_stipe_shell YFB_stipe_center 0.123655 no
DIF_stipe_shell YFB_stipe_shell 0.639294 no
DIF_stipe_shell YFB_stipe_skin 0.955995 no
DIF_stipe_shell YFB_cap_skin 0.186930 no
DIF_stipe_shell YFB_cap_tissue 0.034837 yes
DIF_stipe_shell YFB_gill_tissue 0.176804 no
DIF_stipe_shell YFB_veil 0.480132 no
DIF_stipe_shell DIF_stipe_skin 0.817661 no
DIF_stipe_shell DIF_cap_skin 0.573594 no
DIF_stipe_shell DIF_cap_tissue 0.664948 no
DIF_stipe_skin DIF_gill_tissue 0.694055 no
DIF_stipe_skin YFB_stipe_center 0.273153 no
DIF_stipe_skin YFB_stipe_shell 0.872612 no
DIF_stipe_skin YFB_stipe_skin 0.881135 no
DIF_stipe_skin YFB_cap_skin 0.373742 no
DIF_stipe_skin YFB_cap_tissue 0.083843 no
DIF_stipe_skin YFB_gill_tissue 0.360270 no
DIF_stipe_skin YFB_veil 0.731633 no
DIF_stipe_skin DIF_cap_skin 0.818978 no
DIF_stipe_skin DIF_cap_tissue 0.894718 no
DIF_cap_skin DIF_gill_tissue 0.918588 no
DIF_cap_skin YFB_stipe_center 0.511942 no
DIF_cap_skin YFB_stipe_shell 0.959634 no
DIF_cap_skin YFB_stipe_skin 0.658389 no
DIF_cap_skin YFB_cap_skin 0.632488 no
DIF_cap_skin YFB_cap_tissue 0.207757 no
DIF_cap_skin YFB_gill_tissue 0.620847 no
DIF_cap_skin YFB_veil 0.947723 no
DIF_cap_skin DIF_cap_tissue 0.945819 no
DIF_cap_tissue DIF_gill_tissue 0.847162 no
DIF_cap_tissue YFB_stipe_center 0.412603 no
DIF_cap_tissue YFB_stipe_shell 0.984431 no
DIF_cap_tissue YFB_stipe_skin 0.743230 no
DIF_cap_tissue YFB_cap_skin 0.532984 no
DIF_cap_tissue YFB_cap_tissue 0.143064 no
DIF_cap_tissue YFB_gill_tissue 0.523192 no
DIF_cap_tissue YFB_veil 0.880880 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103700
MLSLTWAILSALTLSVSAGNKIWDGSFNPFTTATDFDKWDWSTPVGTYQWYIHGSQSTSRYLAVSSDYKNPAMSS
EQRGLKLTIDGTSNWNGQTLERTELIPQTSSNLGSGNLFYHFSVKRSSTNPPDSTLEHQVCFFESHFTELKYGVG
SNPTSLTWMISGAEQWNIPFDANTWFNFAYDIDFSAGTVGLWASTGSDPLKKVVQNRSAPTSTNSADWHLGVLRI
VTNQTPEDWYFSGVYVENGPITTAIGSGGSPPSSSPPASTSPSTTQPTTTQAPTTTTAGPTQTQWGQCGGVGWTG
PTVCASPFTCTPVSPPYYSQCI*
Coding >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTAAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATTTCTCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTT
AAAAAGGTCGTTCAAAATAGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATT
GTGACTAACCAGACTCCTGAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATC
GGTAGTGGTGGCAGCCCACCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACG
CAAGCCCCTACTACCACAACTGCGGGACCTACACAAACTCAATGGGGTCAATGTGGAGGAGTAGGCTGGACTGGA
CCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTATTACTCTCAGTGTATCTAA
Transcript >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTAAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATTTCTCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTT
AAAAAGGTCGTTCAAAATAGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATT
GTGACTAACCAGACTCCTGAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATC
GGTAGTGGTGGCAGCCCACCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACG
CAAGCCCCTACTACCACAACTGCGGGACCTACACAAACTCAATGGGGTCAATGTGGAGGAGTAGGCTGGACTGGA
CCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTATTACTCTCAGTGTATCTAA
Gene >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGTATGTATTTGCCTCCCCCACATCTGTTGTTCGAT
GTTCAATAGCTCTTAGGGGATTGGTCCACCCCTGTCGGTACCTATCAATGGGTGAGTTTGAAGGCGGTTGTCAAA
CATACGGCCGACATTTTTACTAAAGGAACATCTTCTAGTACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTG
CCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCTGAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCT
CCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTGATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATT
TGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAATCCCCCTGATGTACGTCCTTCGGAAAGATAACATAAAA
CCTGTACTGAGACTTTCTTTTGCAGTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGGT
ATGTCCTAGTTTCTTGCAGCCCTGAAAGTGCTAATGTTCCTAATTCAGTTAAAATATGGCGTTGGCTCGAACCCT
ACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGGTTCAACTTT
GCCTATGATATTGATGTGAGTAAATATTCTCGAAGTGGTATTTCAGTTGTTAATGACCGCCCGATTGTGAAGTTC
TCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTTAAAAAGGTCGTTCAAAATAGGAGCGCC
CCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATTGTGACTAACCAGACTCCTGAAGACTGG
TATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATCGGTAGTGGTGGCAGCCCACCATCCAGT
AGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACGCAAGCCCCTACTACCACAACTGCGGGA
CCTACACAAACTCAATGGGGTCAATGTGGAGGTATGTATATTGACCAAAAATTCACCGCCAAGAGGCTGACTTTC
ATTGCAGGAGTAGGCTGGACTGGACCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTAT
TACTCTCAGGCATGTATATCTCTTTCATGTGTATCGACTGAAACTGACAATCGTCTTCATAGTGTATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail