Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103700
Gene name
Locationscaffold_7:1661934..1663280
Strand-
Gene length (bp)1346
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain 3.2E-57 22 243
PF00734 CBM_1 Fungal cellulose binding domain 2.8E-10 289 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 265 322 5.0E-10
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 250 322 4.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 289 322 7.0E-09
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 276 322 9.0E-09
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 268 322 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 265 322 5.0E-10
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 250 322 4.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 289 322 7.0E-09
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 276 322 9.0E-09
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 268 322 2.0E-08
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 284 322 4.0E-08
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 284 322 4.0E-08
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 281 321 6.0E-08
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 266 322 6.0E-08
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 278 321 7.0E-08
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 285 322 8.0E-08
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 261 322 1.0E-07
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 289 322 3.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 289 322 3.0E-07
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 289 322 3.0E-07
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 289 322 1.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 289 322 1.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 283 322 2.0E-06
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 285 322 2.0E-06
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 287 322 3.0E-06
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 289 322 4.0E-06
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 289 322 5.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 287 322 5.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 289 322 6.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 241 322 8.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 287 322 9.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 287 322 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103700
MLSLTWAILSALTLSVSAGNKIWDGSFNPFTTATDFDKWDWSTPVGTYQWYIHGSQSTSRYLAVSSDYKNPAMSS
EQRGLKLTIDGTSNWNGQTLERTELIPQTSSNLGSGNLFYHFSVKRSSTNPPDSTLEHQVCFFESHFTELKYGVG
SNPTSLTWMISGAEQWNIPFDANTWFNFAYDIDFSAGTVGLWASTGSDPLKKVVQNRSAPTSTNSADWHLGVLRI
VTNQTPEDWYFSGVYVENGPITTAIGSGGSPPSSSPPASTSPSTTQPTTTQAPTTTTAGPTQTQWGQCGGVGWTG
PTVCASPFTCTPVSPPYYSQCI*
Coding >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTAAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATTTCTCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTT
AAAAAGGTCGTTCAAAATAGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATT
GTGACTAACCAGACTCCTGAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATC
GGTAGTGGTGGCAGCCCACCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACG
CAAGCCCCTACTACCACAACTGCGGGACCTACACAAACTCAATGGGGTCAATGTGGAGGAGTAGGCTGGACTGGA
CCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTATTACTCTCAGTGTATCTAA
Transcript >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTAAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATTTCTCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTT
AAAAAGGTCGTTCAAAATAGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATT
GTGACTAACCAGACTCCTGAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATC
GGTAGTGGTGGCAGCCCACCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACG
CAAGCCCCTACTACCACAACTGCGGGACCTACACAAACTCAATGGGGTCAATGTGGAGGAGTAGGCTGGACTGGA
CCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTATTACTCTCAGTGTATCTAA
Gene >AgabiH97|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAGCGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGTATGTATTTGCCTCCCCCACATCTGTTGTTCGAT
GTTCAATAGCTCTTAGGGGATTGGTCCACCCCTGTCGGTACCTATCAATGGGTGAGTTTGAAGGCGGTTGTCAAA
CATACGGCCGACATTTTTACTAAAGGAACATCTTCTAGTACATCCATGGTAGTCAGTCTACCTCCCGCTACCTTG
CCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCTGAGCAGCGTGGGCTTAAGTTGACAATTGACGGCACCT
CCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTGATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATT
TGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAATCCCCCTGATGTACGTCCTTCGGAAAGATAACATAAAA
CCTGTACTGAGACTTTCTTTTGCAGTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGGT
ATGTCCTAGTTTCTTGCAGCCCTGAAAGTGCTAATGTTCCTAATTCAGTTAAAATATGGCGTTGGCTCGAACCCT
ACCAGCCTAACCTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGATGCCAACACCTGGTTCAACTTT
GCCTATGATATTGATGTGAGTAAATATTCTCGAAGTGGTATTTCAGTTGTTAATGACCGCCCGATTGTGAAGTTC
TCTGCTGGAACTGTTGGGCTCTGGGCTTCTACAGGCTCTGACCCGCTTAAAAAGGTCGTTCAAAATAGGAGCGCC
CCAACGAGCACAAACTCGGCCGACTGGCATCTTGGCGTCCTTCGTATTGTGACTAACCAGACTCCTGAAGACTGG
TATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATCGGTAGTGGTGGCAGCCCACCATCCAGT
AGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACGCAAGCCCCTACTACCACAACTGCGGGA
CCTACACAAACTCAATGGGGTCAATGTGGAGGTATGTATATTGACCAAAAATTCACCGCCAAGAGGCTGACTTTC
ATTGCAGGAGTAGGCTGGACTGGACCCACAGTCTGTGCGAGCCCATTCACTTGCACGCCCGTCTCTCCTCCTTAT
TACTCTCAGGCATGTATATCTCTTTCATGTGTATCGACTGAAACTGACAATCGTCTTCATAGTGTATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail