Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103570
Gene name
Locationscaffold_7:1628553..1630039
Strand+
Gene length (bp)1486
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.9E-13 32 303

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DKJ6|GDL4_ARATH GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=1 125 308 8.0E-09
sp|P40603|APG_BRANA Anther-specific proline-rich protein APG (Fragment) OS=Brassica napus GN=APG PE=2 SV=1 168 298 8.0E-07

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 2 21 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103570
MILPLFALAFVTLIFIPVSVARHFSWDNIKYVYAFGDSYSFVQGTRGHANFSFIGDKLDFAFTPQELLTNEIVPR
NTSSEGSNWLEFLTGCFQGSPFNCPKQLWNFAFAGADIDGDILPLHHDFTIPLVDQVTQWLEFASTVIPHPENET
LTSWWIGINDTGDSNHNTSITDFTAFWEIEMQSYFKAVDLASRHGLKAHLFLNVPPGERSPGSSGNPGLLKDHIQ
LFNSILVDHIHQFTKTHPDNVVITFDTHTWFNRILDHPEKYGFQNVTGFCTCVDPSGYFWYDSGHPTQHVHQLLA
EAIQHRLGG*
Coding >AgabiH97|103570
ATGATACTGCCATTGTTTGCACTGGCGTTTGTTACGCTAATTTTCATCCCTGTTTCCGTAGCTCGTCACTTCTCA
TGGGACAATATCAAATATGTCTATGCCTTTGGTGATTCATATTCGTTCGTACAAGGTACACGAGGTCATGCAAAC
TTCAGTTTCATCGGTGACAAGCTGGATTTCGCGTTTACTCCACAAGAGCTTCTCACAAATGAGATTGTACCTCGT
AATACGAGCTCGGAAGGATCCAACTGGCTCGAATTCCTCACAGGATGTTTTCAAGGCAGTCCCTTCAATTGCCCT
AAACAACTTTGGAATTTCGCATTTGCAGGCGCAGACATCGACGGGGATATACTTCCCCTACATCATGACTTCACC
ATTCCATTAGTCGACCAAGTTACTCAATGGCTAGAGTTCGCATCGACCGTTATACCTCACCCCGAAAACGAGACT
TTAACAAGCTGGTGGATCGGGATCAATGACACTGGTGATTCTAATCACAATACCTCCATCACTGATTTTACAGCA
TTTTGGGAAATAGAGATGCAATCCTACTTTAAAGCTGTTGACCTAGCATCCAGGCATGGTCTCAAAGCCCATCTT
TTCCTCAACGTCCCACCAGGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGATCACATACAA
CTCTTCAACAGCATTCTTGTCGATCATATCCATCAATTCACCAAAACGCATCCAGATAACGTTGTTATCACTTTC
GACACTCATACCTGGTTCAATCGAATCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTTCTGT
ACATGTGTTGACCCGAGTGGCTATTTCTGGTATGATAGCGGCCATCCAACACAACATGTCCACCAGCTTCTGGCC
GAGGCCATACAACATCGATTAGGTGGCTGA
Transcript >AgabiH97|103570
ATGATACTGCCATTGTTTGCACTGGCGTTTGTTACGCTAATTTTCATCCCTGTTTCCGTAGCTCGTCACTTCTCA
TGGGACAATATCAAATATGTCTATGCCTTTGGTGATTCATATTCGTTCGTACAAGGTACACGAGGTCATGCAAAC
TTCAGTTTCATCGGTGACAAGCTGGATTTCGCGTTTACTCCACAAGAGCTTCTCACAAATGAGATTGTACCTCGT
AATACGAGCTCGGAAGGATCCAACTGGCTCGAATTCCTCACAGGATGTTTTCAAGGCAGTCCCTTCAATTGCCCT
AAACAACTTTGGAATTTCGCATTTGCAGGCGCAGACATCGACGGGGATATACTTCCCCTACATCATGACTTCACC
ATTCCATTAGTCGACCAAGTTACTCAATGGCTAGAGTTCGCATCGACCGTTATACCTCACCCCGAAAACGAGACT
TTAACAAGCTGGTGGATCGGGATCAATGACACTGGTGATTCTAATCACAATACCTCCATCACTGATTTTACAGCA
TTTTGGGAAATAGAGATGCAATCCTACTTTAAAGCTGTTGACCTAGCATCCAGGCATGGTCTCAAAGCCCATCTT
TTCCTCAACGTCCCACCAGGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGATCACATACAA
CTCTTCAACAGCATTCTTGTCGATCATATCCATCAATTCACCAAAACGCATCCAGATAACGTTGTTATCACTTTC
GACACTCATACCTGGTTCAATCGAATCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTTCTGT
ACATGTGTTGACCCGAGTGGCTATTTCTGGTATGATAGCGGCCATCCAACACAACATGTCCACCAGCTTCTGGCC
GAGGCCATACAACATCGATTAGGTGGCTGA
Gene >AgabiH97|103570
ATGATACTGCCATTGTTTGCACTGGCGTTTGTTACGCTAATTTTCATCCCTGTTTCCGTAGCTCGTCACTTCTCA
TGGGACAATATCAAATATGTCTATGCCTTTGGTGATTCATATTCGTTCGTACAAGGTACACGAGGTCATGCAAAC
TTCAGGCGCGTTCATCGCAAACTTTCTCTCGAACTCATAATTGCTAAAAGAAAAGATGTCATTCTACAGTTTCAT
CGGTGACAAGCTGGATTTCGCGTTTACTCCACAAGAGCTTCTCACAAATGAGATTGTACCTCGTAATGTAAACTC
TATTCAATTTTGTGACGCAAGGTGTTCCAAGTAGCTGAAAATTAGAACTGATCAGACGAGCTCGGAAGGATCCAA
CTGGGTAAGCTAATCGTCGTTGTATCAATCTCAAAAACAAAAACTTATGTATATATACAAGCTCGAATTCCTCAC
AGGATGTTTTCAAGGCAGTCCCTTCAATTGCCCTAAACAACTTTGGAATTTCGCATTTGCAGGCGCAGACATCGA
CGGGGATATGTAAGTTTTGACATGACACCCACACACATCTTCCTGACATTCTGGCCTTAGACTTCCCCTACATCA
TGACTTCACCATTCCATTAGTCGACCAAGTTACTCAATGGCTAGAGTTCGCATCGACCGTTATACCTCACCCCGA
AAACGAGACTTTAACAAGCTGGTGGATCGGGATCAATGACACTGGTGATTCTAATCACAATACCTCCGTTCGTCA
ATTCGCCTTTTTTTCCATAGACAAGGTTGTTGAACCAAATGTCACTTACACGCAGATCACTGATTTTACAGCATT
TTGGGAAATAGAGATGCAATCCTACTTTAAAGCTGTTGCAAGTCAAGTTCCTCCTTACCACACGTCTAACATATG
GGCCTCTAACCATTTTCATAGGACCTAGCATCCAGGCATGGTCTCAAAGCCCATCTTTTCCTCAACGTCCCACCA
GGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGATCACATACAACTCTTCAACAGCATTCTT
GTCGATCATATCCATCAATTCACCAAAACGCATCCAGGTACAGTACTCCTCATTCATTCACATCCGCAGTTGAAG
ATCACTCGGTGATATTGATATTTATTATAGATAACGTTGTTATCACTTTCGACACTCATACCTGGTTCAATCGAA
TCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTATGTTAAATACAGAAATAAACGGATGCCAT
ACCTTTTTCGACTTTTAACGTTTTCCTCACCGCGGAATTTGCAGGTTCTGTACATGTGTTGACCCGAGTGGCTAT
TTCTGGTATGGTAAGTTCCTGCCTGACACATCATTGCACATGTCCAGTTCTTGAACCTCGTGTAGATAGCGGCCA
TCCAACACAACATGTCCACCAGCTTCTGGCCGAGGCCATACAACATCGATTAGGTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail