Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103490
Gene name
Locationscaffold_7:1610745..1612917
Strand+
Gene length (bp)2172
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20152 DUF6534 Family of unknown function (DUF6534) 1.3E-18 207 291

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1934 0.1779 0.5093 0.259 0.1396 0.0061 0.1544 0.3807 0.5364 0.0832

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 95 117 22
3 200 222 22
4 242 264 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup19
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|004100
Agaricus bisporus var bisporus H39 AgabiH39|406100
Agaricus bisporus var bisporus H39 AgabiH39|386300
Agaricus bisporus var bisporus H39 AgabiH39|386200
Agaricus bisporus var bisporus H39 AgabiH39|102060
Agaricus bisporus var bisporus H39 AgabiH39|095970
Agaricus bisporus var bisporus H39 AgabiH39|103490
Agaricus bisporus var bisporus H39 AgabiH39|095720
Agaricus bisporus var bisporus H39 AgabiH39|022930
Agaricus bisporus var bisporus H39 AgabiH39|020260
Agaricus bisporus var bisporus H39 AgabiH39|020250
Agaricus bisporus var bisporus H39 AgabiH39|095960
Agaricus bisporus var bisporus H97 AgabiH97|096260
Agaricus bisporus var bisporus H97 AgabiH97|103490 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|103480
Agaricus bisporus var bisporus H97 AgabiH97|103470
Agaricus bisporus var bisporus H97 AgabiH97|102060
Agaricus bisporus var bisporus H97 AgabiH97|096250
Agaricus bisporus var bisporus H97 AgabiH97|020260
Agaricus bisporus var bisporus H97 AgabiH97|095960
Agaricus bisporus var bisporus H97 AgabiH97|095720
Agaricus bisporus var bisporus H97 AgabiH97|022930
Agaricus bisporus var bisporus H97 AgabiH97|020250
Agaricus bisporus var bisporus H97 AgabiH97|004100
Agaricus bisporus var bisporus H97 AgabiH97|095970
Rhodonia placenta FPRL280 RhoplFPRL280|25_45
Rhodonia placenta FPRL280 RhoplFPRL280|168_9
Rhodonia placenta FPRL280 RhoplFPRL280|227_13
Rhodonia placenta FPRL280 RhoplFPRL280|435_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103490
MWRNSLCVNRLEWRMSTIGVQNPASTAPHRSPPYYIPVSSSSENKALGQMAGGSEIVHGPLFLGTAFNVLLYGIS
ITQTYLYLTSSKEDKWFIKYFVYFLFITDTIHTVFTLVYLYDSLIKNFGNVPYLETANWIFSTDPALTKSIISLG
SLLYLQTTGNHRWSSTSLLFLESQGFDTQYLPLSIHSFLLRHFIFHGIVVILWLGSSCIADIVITTTMVLYLRRH
RTGFSQTDHQVDRIIRVTMHTGLVTALWALVDLLLYLSSSSGKHLFFNFCLSKLYTNSLMSSLNSRGGWRYNEDS
NAAFAFEHKRSTANFQNQPNSNIMAPEVFVHVESHELVNPALKVDQRIYEDMTSNFDAESKRSIVM*
Coding >AgabiH97|103490
ATGTGGCGTAATAGTTTGTGTGTCAATAGACTGGAGTGGCGGATGTCAACCATTGGTGTACAAAATCCAGCCAGT
ACCGCGCCACATCGTTCCCCTCCCTATTACATCCCAGTCTCGAGCTCGTCGGAGAACAAAGCATTGGGGCAAATG
GCCGGCGGTTCTGAAATAGTTCATGGTCCTCTATTTCTCGGCACTGCTTTCAACGTTTTGCTCTATGGTATATCC
ATCACACAGACGTATCTTTACTTAACTAGTTCCAAAGAGGACAAGTGGTTCATCAAATACTTCGTCTACTTCTTG
TTCATCACCGACACCATTCATACAGTCTTTACTCTCGTTTACTTATACGACTCCTTGATCAAGAACTTTGGAAAT
GTTCCCTATCTTGAGACAGCGAACTGGATTTTCTCTACTGATCCAGCTCTGACTAAGTCTATAATCTCCCTCGGA
AGCCTTTTATATCTTCAAACCACAGGGAATCATCGGTGGAGCAGTACAAGCCTTCTTTTCTTGGAGAGTCAAGGT
TTTGACACGCAATACCTTCCTCTCTCTATTCATTCTTTTCTGCTCCGTCATTTCATTTTTCATGGAATCGTCGTC
ATCCTCTGGTTGGGATCTTCTTGTATAGCTGATATTGTGATCACCACCACCATGGTATTATACCTTCGAAGGCAT
AGAACAGGATTCTCACAGACTGACCATCAGGTTGATAGAATCATTCGAGTTACTATGCATACAGGTCTGGTTACA
GCATTGTGGGCTCTTGTTGACCTACTACTCTACCTATCAAGTTCATCTGGAAAACATTTATTTTTCAATTTTTGT
TTATCAAAATTGTACACCAACTCTCTCATGAGTAGTCTCAATTCTCGCGGTGGATGGAGATACAATGAAGACAGT
AATGCTGCGTTCGCTTTTGAACACAAACGGTCTACTGCAAATTTTCAAAATCAACCGAACTCTAACATCATGGCA
CCTGAGGTTTTCGTTCACGTCGAATCGCACGAATTGGTCAATCCTGCCCTTAAAGTCGATCAAAGAATCTATGAG
GATATGACTAGTAATTTCGATGCCGAGTCCAAGAGAAGTATAGTTATGTGA
Transcript >AgabiH97|103490
ATGTGGCGTAATAGTTTGTGTGTCAATAGACTGGAGTGGCGGATGTCAACCATTGGTGTACAAAATCCAGCCAGT
ACCGCGCCACATCGTTCCCCTCCCTATTACATCCCAGTCTCGAGCTCGTCGGAGAACAAAGCATTGGGGCAAATG
GCCGGCGGTTCTGAAATAGTTCATGGTCCTCTATTTCTCGGCACTGCTTTCAACGTTTTGCTCTATGGTATATCC
ATCACACAGACGTATCTTTACTTAACTAGTTCCAAAGAGGACAAGTGGTTCATCAAATACTTCGTCTACTTCTTG
TTCATCACCGACACCATTCATACAGTCTTTACTCTCGTTTACTTATACGACTCCTTGATCAAGAACTTTGGAAAT
GTTCCCTATCTTGAGACAGCGAACTGGATTTTCTCTACTGATCCAGCTCTGACTAAGTCTATAATCTCCCTCGGA
AGCCTTTTATATCTTCAAACCACAGGGAATCATCGGTGGAGCAGTACAAGCCTTCTTTTCTTGGAGAGTCAAGGT
TTTGACACGCAATACCTTCCTCTCTCTATTCATTCTTTTCTGCTCCGTCATTTCATTTTTCATGGAATCGTCGTC
ATCCTCTGGTTGGGATCTTCTTGTATAGCTGATATTGTGATCACCACCACCATGGTATTATACCTTCGAAGGCAT
AGAACAGGATTCTCACAGACTGACCATCAGGTTGATAGAATCATTCGAGTTACTATGCATACAGGTCTGGTTACA
GCATTGTGGGCTCTTGTTGACCTACTACTCTACCTATCAAGTTCATCTGGAAAACATTTATTTTTCAATTTTTGT
TTATCAAAATTGTACACCAACTCTCTCATGAGTAGTCTCAATTCTCGCGGTGGATGGAGATACAATGAAGACAGT
AATGCTGCGTTCGCTTTTGAACACAAACGGTCTACTGCAAATTTTCAAAATCAACCGAACTCTAACATCATGGCA
CCTGAGGTTTTCGTTCACGTCGAATCGCACGAATTGGTCAATCCTGCCCTTAAAGTCGATCAAAGAATCTATGAG
GATATGACTAGTAATTTCGATGCCGAGTCCAAGAGAAGTATAGTTATGTGA
Gene >AgabiH97|103490
ATGTGGCGTAATAGTTTGTGTAAGCCGCTGTTCACCACTTTCTGCGGCGTCGTCTAATCCATGTCATTCAGGTGT
CAGTCCTGATTCAACATCTGCTTCAATCGTCTTGCCTTTTTGAAATATGAACCGCGAGATATGCGTTAGATAGAC
TGGAGTGGCGGATGTCAACCATTGGTGTACAAAATCCAGCCAGTACCGCGCCACATCGTTCCCCTCCCTATTACA
TCCCAGTCTCGAGCTCGTCGGAGAACAAAGCATTGGGGCAAATGGCCGGCGGTTCTGAAATAGTGTTCGTATTAT
CTGATTGTTATGCCAGTTTCATAATCGATAATGCAGATTCTAGTCATGGTCCTCTATTTCTCGGCACTGCTTTCA
ACGTTTTGCTCTATGGTATATCCATCACACAGACGTATCTTTACTTAACTAGTTCCAAAGAGTAAGTTCTCATTA
GCTGCTATTGTTTGTTCTAAAAGCACATGTGTCTAGGGACAAGTGGTTCATCAAATACTTCGTGAGTAATAACGG
AAAAAACTGTATATATGAATTCGATGAATCAAATACTTTCTGCGGACAGGTCTACTTCTTGTTCATCACCGACAC
CATTCATACAGTCTTTACTCTCGTTTACTTATACGACTCCTTGATCAAGAACTTTGGTGATTGATTTCGCGCTGC
GTCGAAAACCAGCAACCTTACAACCGAACTGTAGGAAATGTTCCCTATCTTGAGACAGCGAACTGGATTTTCTCT
ACTGGTTCGTCTTATTCAAAAAGAAATATTTCTGCCCATTTTGAATTCCTTTCGCTGTCTCACAGATCCAGCTCT
GACTAAGTCTATAATCTCCCTCGGAAGCCTTTTATATCTTCAAACCACAGGGAATCATCGGTGGAGCAGTACAAG
CCTTCTTTTCTTGGAGAGTCAAGGTTTTGACACGCAATACCTTCCTCTCTCTATTCATTCTTTTCTGCTCCGTCA
TTTCATTTTGTGAGTCGCTTCCCCTCGGATTTTAACCCGCCACATCCCAAATATAACACGTAACACGCACAGTCA
TGGGTTTGGCTACCGCCGCTGCCATAGCTTTCATTCCCAAGTTCATCGAATTTCAGAGATTTAGAATCGTCGTCA
TCCTCTGTGAGCCCCTCCCTTATGTCAATATATGTAACGGACCTTAATATCGTTTCTTGCAAGGGTTGGGATCTT
CTTGTATAGCTGATATTGTGATCACCACCACCATGGTATTATACCTTGTGAGTTAATAGAGGAATAATTCCTCAT
CGTTATATCCACCTTGTTTTCTGGTTAACCCGTCTTGTAAAGCGAAGGCATAGAACAGGATTCTCACAGACTGAC
CATCAGGTTGATAGAATCATTCGAGGTCAGTTTGACTCTGATATTTCTACGCTTTTATCTGATCACAATCATTCG
TTTAGTTACTATGCATACAGGTAAGAAACATCATACTCTCACTGCCCGAAGCCCCGCTCATACCTGTTATCCTTG
CCAGGTCTGGTTACAGCATTGTGGGCGTACGTATCCACGCATTCTAAGCATTGAGTTGAGCTGATACATCTAGGC
ATACAGTCTTGTTGACCTACTACTCTACCTATCAAGTGTAAGTCGTACTAGGCTATCTCTTCGTCGAATCCAAAT
ATATCTATTAACCTGTATCTTTCTCTTTCGTCGACTAGTCATCTGGAAAGTAAGAACCTTTCTCTACCTAAAACA
TTGCCATATCGGAATCCCTGACGGCGAAACAAACCCATCACTCAGACATTTATTTTTCAATTTTTGTTTATCAAA
ATTGTACACCAACTCTCTCATGAGTAGTCTCAATTCTCGCGGTGGATGGAGATACAATGAAGACAGTAATGCTGC
GTTCGCTTTTGAACACAAACGGGTATGTTGGGCTCGCGTACTTGTCCCTCATTGTCTGACTGTCTCATATAGTCT
ACTGCAAATTTTCAAAATCAACCGAACTCTAACATCATGGCACCTGAGGTTCGCTCCCGCAAGTTTTAAGAATGT
TCAAAGAATAGCTAACTTCAGACATAGGTTTTCGTTCACGTCGAATCGCACGAATTGGTCAATCCTGCCCTTAAA
GTCGATCAAAGAATCTATGAGGATATGACTAGTAATTTCGATGCCGAGTCCAAGAGAAGTATAGTTATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail