Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103370
Gene name
Locationscaffold_7:1587425..1592258
Strand+
Gene length (bp)4833
Transcript length (bp)3576
Coding sequence length (bp)3576
Protein length (aa) 1192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08356 EF_assoc_2 EF hand associated 4.4E-35 277 362
PF08355 EF_assoc_1 EF hand associated 1.2E-29 398 466
PF00071 Ras Ras family 2.2E-20 61 223
PF00071 Ras Ras family 3.0E-05 477 589
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 2.2E-09 61 173
PF00092 VWA von Willebrand factor type A domain 7.6E-08 765 935

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 57 700 0.0E+00
sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 57 700 0.0E+00
sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 56 699 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 60 674 5.0E-180
sp|Q7RZA2|GEM1_NEUCR Mitochondrial Rho GTPase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gem-1 PE=3 SV=1 56 656 1.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 57 700 0.0E+00
sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 57 700 0.0E+00
sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 56 699 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 60 674 5.0E-180
sp|Q7RZA2|GEM1_NEUCR Mitochondrial Rho GTPase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gem-1 PE=3 SV=1 56 656 1.0E-176
sp|Q4WN24|GEM1_ASPFU Mitochondrial Rho GTPase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gem1 PE=3 SV=1 60 639 4.0E-169
sp|Q2UM43|GEM1_ASPOR Mitochondrial Rho GTPase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gem1 PE=3 SV=1 60 639 1.0E-163
sp|Q5B5L3|GEM1_EMENI Mitochondrial Rho GTPase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gem1 PE=3 SV=1 60 639 1.0E-160
sp|Q5ZM83|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1 56 615 2.0E-158
sp|Q6C2J1|GEM1_YARLI Mitochondrial Rho GTPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GEM1 PE=3 SV=1 60 640 2.0E-152
sp|Q8BG51|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=1 SV=1 55 635 2.0E-152
sp|Q6NVC5|MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio GN=rhot1a PE=2 SV=1 56 635 1.0E-151
sp|Q8JZN7|MIRO2_MOUSE Mitochondrial Rho GTPase 2 OS=Mus musculus GN=Rhot2 PE=1 SV=1 56 635 4.0E-151
sp|Q8IXI2|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2 56 635 1.0E-150
sp|Q2HJF8|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1 55 635 3.0E-150
sp|Q5E9M9|MIRO2_BOVIN Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1 56 615 1.0E-148
sp|Q5ZM73|MIRO1_CHICK Mitochondrial Rho GTPase 1 OS=Gallus gallus GN=RHOT1 PE=2 SV=1 56 635 2.0E-148
sp|Q8IXI1|MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens GN=RHOT2 PE=1 SV=2 56 615 3.0E-148
sp|Q6DIS1|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1 56 670 9.0E-148
sp|Q7TSA0|MIRO2_RAT Mitochondrial Rho GTPase 2 OS=Rattus norvegicus GN=Rhot2 PE=2 SV=1 56 637 2.0E-146
sp|Q32LU1|MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio GN=rhot2 PE=2 SV=1 56 670 3.0E-146
sp|Q6CY37|GEM1_KLULA Mitochondrial Rho GTPase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GEM1 PE=3 SV=1 60 661 2.0E-145
sp|O59781|GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gem1 PE=3 SV=1 58 614 2.0E-144
sp|Q8IMX7|MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster GN=Miro PE=1 SV=1 57 619 2.0E-144
sp|Q298L5|MIRO_DROPS Mitochondrial Rho GTPase OS=Drosophila pseudoobscura pseudoobscura GN=Miro PE=3 SV=1 57 619 4.0E-144
sp|P39722|GEM1_YEAST Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEM1 PE=1 SV=1 57 672 2.0E-143
sp|Q758X6|GEM1_ASHGO Mitochondrial Rho GTPase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GEM1 PE=3 SV=1 57 639 1.0E-142
sp|F4J0W4|MIRO2_ARATH Mitochondrial Rho GTPase 2 OS=Arabidopsis thaliana GN=MIRO2 PE=2 SV=1 57 639 4.0E-139
sp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana GN=MIRO1 PE=1 SV=1 58 639 2.0E-137
sp|Q6FIR8|GEM1_CANGA Mitochondrial Rho GTPase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GEM1 PE=3 SV=1 57 640 3.0E-136
sp|Q94263|MIRO1_CAEEL Mitochondrial Rho GTPase 1 OS=Caenorhabditis elegans GN=miro-1 PE=3 SV=1 55 635 5.0E-133
sp|Q5ABR2|GEM1_CANAL Mitochondrial Rho GTPase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GEM1 PE=3 SV=2 105 640 7.0E-132
sp|Q864R5|MIRO2_PIG Mitochondrial Rho GTPase 2 OS=Sus scrofa GN=RHOT2 PE=2 SV=1 56 615 2.0E-129
sp|Q623S8|MIRO1_CAEBR Mitochondrial Rho GTPase 1 OS=Caenorhabditis briggsae GN=miro-1 PE=3 SV=3 55 635 8.0E-129
sp|Q9MA88|MIRO3_ARATH Mitochondrial Rho GTPase 3 OS=Arabidopsis thaliana GN=MIRO3 PE=2 SV=1 60 639 3.0E-116
sp|Q55G45|GEMA_DICDI Probable mitochondrial Rho GTPase gemA OS=Dictyostelium discoideum GN=gemA PE=3 SV=1 56 584 2.0E-103
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 57 224 3.0E-14
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 61 225 5.0E-14
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 57 236 9.0E-14
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 61 225 9.0E-14
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 57 238 9.0E-14
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 61 225 2.0E-13
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 61 225 3.0E-13
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 61 225 3.0E-13
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 61 225 3.0E-13
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 61 225 3.0E-13
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 61 225 3.0E-13
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 61 225 3.0E-13
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 61 225 4.0E-13
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 61 225 5.0E-13
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 61 225 1.0E-12
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 61 225 2.0E-12
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 61 225 2.0E-12
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 61 225 2.0E-12
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 61 225 2.0E-12
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 61 225 8.0E-12
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 61 225 9.0E-12
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 61 225 1.0E-11
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 61 225 1.0E-11
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 61 225 1.0E-11
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 61 225 1.0E-11
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 61 225 4.0E-11
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 55 229 4.0E-11
sp|Q6B9X6|VWKA_DICDI Alpha-protein kinase vwkA OS=Dictyostelium discoideum GN=vwkA PE=1 SV=1 764 920 5.0E-11
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 60 224 5.0E-11
sp|Q5UQ35|YR811_MIMIV Putative ariadne-like RING finger protein R811 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R811 PE=3 SV=1 759 988 5.0E-11
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 58 229 3.0E-10
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 61 229 3.0E-10
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 55 225 5.0E-10
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 60 216 6.0E-10
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 58 224 7.0E-10
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 55 226 8.0E-10
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 60 228 9.0E-10
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 58 226 1.0E-09
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 60 226 1.0E-09
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 53 224 2.0E-09
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 58 224 2.0E-09
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 58 223 2.0E-09
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 61 216 3.0E-09
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 61 216 3.0E-09
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 58 224 3.0E-09
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 58 224 3.0E-09
sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 60 226 4.0E-09
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 60 226 4.0E-09
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 60 226 4.0E-09
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 58 224 5.0E-09
sp|Q9JJL4|RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 60 226 6.0E-09
sp|Q8R527|RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 60 226 6.0E-09
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 60 226 6.0E-09
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 60 226 7.0E-09
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 60 226 7.0E-09
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 60 226 7.0E-09
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 60 226 7.0E-09
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 60 226 7.0E-09
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 60 226 7.0E-09
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 60 227 7.0E-09
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 61 216 8.0E-09
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 60 227 8.0E-09
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 58 224 8.0E-09
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 58 226 8.0E-09
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 61 231 8.0E-09
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 58 216 8.0E-09
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 58 216 9.0E-09
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 58 216 9.0E-09
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 58 216 9.0E-09
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 58 216 9.0E-09
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 54 216 9.0E-09
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 58 224 1.0E-08
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 58 216 1.0E-08
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 60 226 1.0E-08
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 58 224 1.0E-08
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 58 216 1.0E-08
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 58 216 1.0E-08
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 58 216 1.0E-08
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 60 238 1.0E-08
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 56 224 1.0E-08
sp|Q54HZ7|RACM_DICDI Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 58 216 1.0E-08
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 60 226 1.0E-08
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 51 224 2.0E-08
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 61 223 2.0E-08
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 55 229 2.0E-08
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 60 224 2.0E-08
sp|P25378|RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 61 223 2.0E-08
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 60 226 2.0E-08
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 60 226 2.0E-08
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 58 224 2.0E-08
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 58 228 2.0E-08
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 61 216 2.0E-08
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 56 224 2.0E-08
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 56 224 3.0E-08
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 58 225 3.0E-08
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 58 226 3.0E-08
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 62 233 3.0E-08
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 61 223 4.0E-08
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 58 225 4.0E-08
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 58 224 4.0E-08
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 58 229 4.0E-08
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 60 216 5.0E-08
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 61 216 6.0E-08
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 53 224 6.0E-08
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 60 226 7.0E-08
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 58 224 7.0E-08
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 61 216 7.0E-08
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 61 216 8.0E-08
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 58 229 9.0E-08
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 58 229 1.0E-07
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 58 229 1.0E-07
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 61 228 1.0E-07
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 61 219 1.0E-07
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 61 216 1.0E-07
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 61 216 1.0E-07
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 61 241 1.0E-07
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 61 216 1.0E-07
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 60 226 1.0E-07
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 58 238 1.0E-07
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 58 238 1.0E-07
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 58 238 1.0E-07
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 61 216 1.0E-07
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 61 216 2.0E-07
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 61 216 2.0E-07
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 61 216 2.0E-07
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 61 216 2.0E-07
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 61 216 2.0E-07
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 61 216 2.0E-07
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 58 226 2.0E-07
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 58 226 2.0E-07
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 58 226 2.0E-07
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 58 224 2.0E-07
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 61 216 2.0E-07
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 61 237 2.0E-07
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 61 216 2.0E-07
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 61 216 2.0E-07
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 61 216 2.0E-07
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 61 216 2.0E-07
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 60 217 2.0E-07
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 53 223 2.0E-07
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 60 216 2.0E-07
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 58 238 2.0E-07
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 58 238 2.0E-07
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 58 238 2.0E-07
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 58 238 2.0E-07
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 58 238 2.0E-07
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 58 238 2.0E-07
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 58 238 2.0E-07
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 59 217 2.0E-07
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 53 223 2.0E-07
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 60 224 2.0E-07
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 60 224 2.0E-07
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 58 229 3.0E-07
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 61 216 3.0E-07
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 61 237 3.0E-07
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 61 216 3.0E-07
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 58 224 4.0E-07
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 60 226 4.0E-07
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 60 216 4.0E-07
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 61 237 4.0E-07
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 57 216 4.0E-07
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 56 226 5.0E-07
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 61 216 5.0E-07
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 57 224 5.0E-07
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 61 224 6.0E-07
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 59 217 6.0E-07
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 61 216 6.0E-07
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 58 216 7.0E-07
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 58 226 7.0E-07
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 58 216 8.0E-07
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 66 216 9.0E-07
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 61 237 9.0E-07
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 61 216 9.0E-07
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 61 216 9.0E-07
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 61 224 1.0E-06
sp|Q9BW83|IFT27_HUMAN Intraflagellar transport protein 27 homolog OS=Homo sapiens GN=IFT27 PE=1 SV=1 61 183 1.0E-06
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 61 237 1.0E-06
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 61 237 1.0E-06
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 61 216 1.0E-06
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 61 216 1.0E-06
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 60 224 2.0E-06
sp|P08647|RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 58 217 2.0E-06
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 57 216 2.0E-06
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 61 216 2.0E-06
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 54 217 2.0E-06
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 60 239 2.0E-06
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 57 225 2.0E-06
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 61 216 2.0E-06
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 61 216 2.0E-06
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 61 216 2.0E-06
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 61 224 2.0E-06
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 58 216 2.0E-06
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 58 216 2.0E-06
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 61 174 2.0E-06
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 61 216 2.0E-06
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 58 217 3.0E-06
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 61 259 3.0E-06
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 59 217 3.0E-06
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 58 226 3.0E-06
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 60 226 3.0E-06
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 60 229 3.0E-06
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 60 216 3.0E-06
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 60 217 3.0E-06
sp|Q8R367|RERG_MOUSE Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 59 217 3.0E-06
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 61 189 4.0E-06
sp|Q0VCJ7|RERG_BOVIN Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 59 217 4.0E-06
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 57 224 4.0E-06
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 60 217 5.0E-06
sp|Q9ER71|RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2 54 175 7.0E-06
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 61 253 7.0E-06
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 60 174 8.0E-06
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 60 231 8.0E-06
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 58 216 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103370
MRSGTRYKVNKSQHFAQHVELDHVREWRTTADGIRVVAQFSFSPTPAAIDFQLREMRRDVRILLVGDEGVGKSTI
ITSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQDRAHLESEIRKAHVICVVYSIDNPNSFDRIPT
YWLPHFRQLGVNVPVILIGNKIDLRGGEVTNEALEDEIVPIMNEFKEVETCVECSAKLPLNVSEVFYFAQKAVLH
PTAPLYDSRDHVLKPACVAALRRIFKICDTNKDGILDAAELNEFQRKCFDAPLQLQELEGIRAMVQEHADGGVRD
EGLTEAGFLYLHTIFIQRGRLETTWTVLRKFGYAEDLRLTEAFLMPRFDVPSDCSVELSPLGYQFFTDIFETFDK
DQDGALKIDELDEVFSTSPGNPWATQKFPDTTLSDDTGAVTLQGWLAQWSMTTLLDHKITLAYLAYLGYPGESQT
EALQVTRARKLDRRKGKVTRNVFLCYVCGAAGSGKTALLRAFAGKPYNPAYEPTSKPINVVNAVDLDGSEKYLVL
QEFGSRYEAETLRSSKKTDQPDVIVYVHDSSDTNSFSYISNLRQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV
YCRRLSLQVPVSVSVKDGQLADVFHTICRIAMNPNSAIPGGADRALTPAARLRMYFTLTAILGGCTAALVVLFRN
VRTPLGLGGWGAPWSSWLLGVGGRRYPVESERGQSCGDSDFKSLTCADPSLHRSLSPKQAMDIDPVTEVSEQPPL
SHLRTAADEDRKMLDLVFIQDCTGSQGSYITSATKNIEAICAYIFESGKLQYQDDLRVGLVAFRDHPPQDHTYIT
KNFGFSSDISKVHKDLSTLYASGGGDGPEAITAALADALHMDWREGATKMIVLIADAPPHGIGEYGDGFDDGSPD
GYDPLTLVRIMATKGITLFFVACEPALSGYSYATDFYQAITNITSGLMLPLTTADLLAHAIVGSVLENLDMERLV
LEVGAAVAERIHGNHESVDDVARELHERLLLRNENTKKVVIESIYKESEEAKHNVNVFMHANSLAEARPLLKRVH
GTRFTEKYLQSRQHLSRHSYPYGSLYTPSRSPPPKIKPLPFSRSPPSSPPRKVVSDFAPFGAPKNSSVFGTAVQS
TPFSLAGGKAAFGAIRPGAAKTGFDDDDDDDDSMPQRVELREGSISLEQAKRIAMQSAWRSAPTHG*
Coding >AgabiH97|103370
ATGCGTTCAGGCACGCGATACAAAGTGAACAAGAGTCAGCATTTTGCTCAGCATGTGGAGCTGGATCACGTGAGA
GAATGGAGGACGACTGCCGATGGAATTCGTGTCGTCGCTCAATTCTCTTTTTCACCGACTCCCGCTGCCATCGAC
TTTCAACTCCGGGAAATGAGGCGAGATGTACGCATTCTCCTCGTCGGCGATGAGGGTGTAGGCAAGAGCACCATC
ATCACGTCCCTAATTAAGGAATCCTTCGTCGCTCATGTTCAACATGTTGTTCCCGAGGTTACAATTCCTCCGGAG
GTCACTCCGGAAAACGTCACGACCTACATCGTCGATTCGGGAGCCGGACCGCAGGACCGTGCGCATCTCGAATCC
GAAATCAGAAAAGCGCATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACC
TACTGGTTACCGCACTTCCGCCAACTTGGTGTTAACGTCCCTGTTATCCTCATTGGCAATAAAATCGACTTGCGT
GGCGGAGAGGTTACCAACGAGGCACTGGAGGATGAGATTGTTCCTATTATGAACGAGTTTAAGGAAGTAGAAACT
TGCGTCGAGTGTTCCGCCAAACTTCCCCTCAACGTTTCTGAAGTCTTCTATTTTGCTCAGAAGGCTGTTTTACAT
CCTACAGCACCCCTCTATGATTCTCGCGATCATGTCCTCAAGCCTGCATGTGTAGCGGCACTACGTCGAATATTT
AAAATTTGCGACACAAATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAGCGTAAATGTTTCGAT
GCCCCTCTACAGCTACAAGAACTCGAAGGCATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGAT
GAGGGCCTAACTGAAGCTGGTTTCTTATATCTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGG
ACTGTGTTACGCAAATTCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGATTTGACGTT
CCTTCGGATTGCTCTGTTGAACTGAGTCCATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAA
GATCAGGATGGCGCCCTCAAGATCGACGAGTTGGATGAAGTTTTCAGTACATCGCCCGGTAATCCTTGGGCAACG
CAAAAGTTTCCTGACACGACATTGTCTGATGACACGGGCGCTGTGACATTACAGGGGTGGTTAGCCCAATGGAGT
ATGACAACACTCTTGGACCACAAAATCACGCTCGCATATCTAGCGTATTTGGGCTACCCTGGTGAATCACAGACC
GAAGCATTACAAGTGACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTTACGCGAAATGTCTTTTTGTGT
TATGTTTGTGGTGCAGCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCAGGGAAGCCTTATAACCCCGCG
TACGAGCCCACGAGTAAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGGTCAGAAAAGTACTTGGTGCTG
CAAGAGTTTGGATCACGTTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTT
TACGTGCACGACTCGAGCGACACAAATTCGTTTTCATATATCAGCAACCTACGGCAACAATATAGTTTGGACCAT
ATACCCACACTTTTCGTGGCAACGAAGTCTGATTTGGACCTAGCGTTACAGCGGCATGAAGTGCAACCAGATGTG
TATTGCAGACGATTAAGCCTGCAAGTGCCCGTGTCCGTCAGTGTCAAGGATGGACAATTGGCAGACGTGTTTCAT
ACTATTTGCAGAATAGCGATGAACCCTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACACCAGCCGCG
AGGCTAAGGATGTATTTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTATTTCGGAAT
GTACGGACACCGCTAGGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGCGGTAGACGA
TATCCGGTAGAGTCCGAAAGAGGACAGAGTTGTGGAGACTCTGACTTTAAAAGTCTGACCTGCGCTGATCCATCT
CTCCATCGATCCCTCTCTCCCAAACAAGCCATGGACATCGACCCGGTTACTGAGGTCAGTGAGCAGCCGCCTCTC
TCCCACCTCAGGACGGCCGCCGACGAGGATAGAAAGATGCTGGACCTCGTCTTTATCCAGGACTGCACCGGCAGC
CAGGGATCCTACATCACATCTGCAACAAAGAACATCGAGGCCATCTGTGCTTATATCTTCGAGTCTGGCAAACTC
CAGTACCAAGACGATTTGAGGGTCGGTCTGGTCGCTTTTCGAGACCATCCGCCACAGGATCATACATACATCACC
AAGAACTTTGGCTTTTCATCAGACATTAGCAAAGTTCATAAAGACCTTTCGACCTTGTATGCTTCAGGCGGTGGA
GATGGTCCTGAAGCTATCACTGCAGCTCTTGCTGATGCCTTGCACATGGATTGGAGGGAAGGAGCAACCAAGATG
ATTGTCCTTATTGCTGACGCACCTCCACATGGTATTGGCGAGTATGGCGATGGTTTTGACGATGGATCACCAGAT
GGTTATGATCCACTGACTCTTGTCAGGATCATGGCGACTAAGGGTATTACGCTGTTCTTTGTGGCTTGTGAACCT
GCACTCAGTGGTTACTCGTATGCTACGGATTTCTATCAAGCGATAACCAACATCACTTCTGGATTGATGCTCCCG
CTCACAACTGCCGACCTCCTCGCACATGCTATTGTTGGTAGCGTGCTAGAGAACCTGGATATGGAACGACTTGTT
CTAGAAGTTGGTGCTGCTGTCGCGGAACGTATTCATGGAAACCACGAGAGCGTCGATGATGTGGCCCGTGAACTG
CACGAGAGGCTTTTGTTGCGGAATGAAAACACAAAGAAGGTTGTTATCGAAAGCATATACAAGGAGTCGGAAGAG
GCGAAACATAATGTTAATGTGTTTATGCATGCCAATTCTTTGGCTGAGGCTCGACCTCTGTTGAAACGGGTGCAT
GGTACTCGATTCACAGAGAAATATCTACAGTCAAGGCAGCATCTCTCACGTCACTCATACCCTTACGGTTCATTG
TATACACCCTCGCGTTCACCACCGCCCAAAATCAAACCCTTACCCTTCTCACGATCTCCGCCATCATCACCACCG
CGTAAAGTCGTCAGTGATTTCGCGCCGTTCGGGGCTCCGAAGAATTCTAGCGTGTTTGGTACGGCAGTTCAGTCA
ACGCCTTTCTCACTCGCCGGCGGGAAAGCCGCTTTCGGTGCTATAAGGCCCGGTGCTGCGAAGACAGGGTTTGAC
GATGATGACGATGACGATGATTCAATGCCGCAACGGGTAGAATTACGAGAAGGCTCAATTTCGCTTGAACAGGCA
AAACGGATTGCGATGCAAAGTGCTTGGCGAAGTGCCCCAACACATGGATAG
Transcript >AgabiH97|103370
ATGCGTTCAGGCACGCGATACAAAGTGAACAAGAGTCAGCATTTTGCTCAGCATGTGGAGCTGGATCACGTGAGA
GAATGGAGGACGACTGCCGATGGAATTCGTGTCGTCGCTCAATTCTCTTTTTCACCGACTCCCGCTGCCATCGAC
TTTCAACTCCGGGAAATGAGGCGAGATGTACGCATTCTCCTCGTCGGCGATGAGGGTGTAGGCAAGAGCACCATC
ATCACGTCCCTAATTAAGGAATCCTTCGTCGCTCATGTTCAACATGTTGTTCCCGAGGTTACAATTCCTCCGGAG
GTCACTCCGGAAAACGTCACGACCTACATCGTCGATTCGGGAGCCGGACCGCAGGACCGTGCGCATCTCGAATCC
GAAATCAGAAAAGCGCATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACC
TACTGGTTACCGCACTTCCGCCAACTTGGTGTTAACGTCCCTGTTATCCTCATTGGCAATAAAATCGACTTGCGT
GGCGGAGAGGTTACCAACGAGGCACTGGAGGATGAGATTGTTCCTATTATGAACGAGTTTAAGGAAGTAGAAACT
TGCGTCGAGTGTTCCGCCAAACTTCCCCTCAACGTTTCTGAAGTCTTCTATTTTGCTCAGAAGGCTGTTTTACAT
CCTACAGCACCCCTCTATGATTCTCGCGATCATGTCCTCAAGCCTGCATGTGTAGCGGCACTACGTCGAATATTT
AAAATTTGCGACACAAATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAGCGTAAATGTTTCGAT
GCCCCTCTACAGCTACAAGAACTCGAAGGCATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGAT
GAGGGCCTAACTGAAGCTGGTTTCTTATATCTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGG
ACTGTGTTACGCAAATTCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGATTTGACGTT
CCTTCGGATTGCTCTGTTGAACTGAGTCCATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAA
GATCAGGATGGCGCCCTCAAGATCGACGAGTTGGATGAAGTTTTCAGTACATCGCCCGGTAATCCTTGGGCAACG
CAAAAGTTTCCTGACACGACATTGTCTGATGACACGGGCGCTGTGACATTACAGGGGTGGTTAGCCCAATGGAGT
ATGACAACACTCTTGGACCACAAAATCACGCTCGCATATCTAGCGTATTTGGGCTACCCTGGTGAATCACAGACC
GAAGCATTACAAGTGACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTTACGCGAAATGTCTTTTTGTGT
TATGTTTGTGGTGCAGCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCAGGGAAGCCTTATAACCCCGCG
TACGAGCCCACGAGTAAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGGTCAGAAAAGTACTTGGTGCTG
CAAGAGTTTGGATCACGTTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTT
TACGTGCACGACTCGAGCGACACAAATTCGTTTTCATATATCAGCAACCTACGGCAACAATATAGTTTGGACCAT
ATACCCACACTTTTCGTGGCAACGAAGTCTGATTTGGACCTAGCGTTACAGCGGCATGAAGTGCAACCAGATGTG
TATTGCAGACGATTAAGCCTGCAAGTGCCCGTGTCCGTCAGTGTCAAGGATGGACAATTGGCAGACGTGTTTCAT
ACTATTTGCAGAATAGCGATGAACCCTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACACCAGCCGCG
AGGCTAAGGATGTATTTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTATTTCGGAAT
GTACGGACACCGCTAGGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGCGGTAGACGA
TATCCGGTAGAGTCCGAAAGAGGACAGAGTTGTGGAGACTCTGACTTTAAAAGTCTGACCTGCGCTGATCCATCT
CTCCATCGATCCCTCTCTCCCAAACAAGCCATGGACATCGACCCGGTTACTGAGGTCAGTGAGCAGCCGCCTCTC
TCCCACCTCAGGACGGCCGCCGACGAGGATAGAAAGATGCTGGACCTCGTCTTTATCCAGGACTGCACCGGCAGC
CAGGGATCCTACATCACATCTGCAACAAAGAACATCGAGGCCATCTGTGCTTATATCTTCGAGTCTGGCAAACTC
CAGTACCAAGACGATTTGAGGGTCGGTCTGGTCGCTTTTCGAGACCATCCGCCACAGGATCATACATACATCACC
AAGAACTTTGGCTTTTCATCAGACATTAGCAAAGTTCATAAAGACCTTTCGACCTTGTATGCTTCAGGCGGTGGA
GATGGTCCTGAAGCTATCACTGCAGCTCTTGCTGATGCCTTGCACATGGATTGGAGGGAAGGAGCAACCAAGATG
ATTGTCCTTATTGCTGACGCACCTCCACATGGTATTGGCGAGTATGGCGATGGTTTTGACGATGGATCACCAGAT
GGTTATGATCCACTGACTCTTGTCAGGATCATGGCGACTAAGGGTATTACGCTGTTCTTTGTGGCTTGTGAACCT
GCACTCAGTGGTTACTCGTATGCTACGGATTTCTATCAAGCGATAACCAACATCACTTCTGGATTGATGCTCCCG
CTCACAACTGCCGACCTCCTCGCACATGCTATTGTTGGTAGCGTGCTAGAGAACCTGGATATGGAACGACTTGTT
CTAGAAGTTGGTGCTGCTGTCGCGGAACGTATTCATGGAAACCACGAGAGCGTCGATGATGTGGCCCGTGAACTG
CACGAGAGGCTTTTGTTGCGGAATGAAAACACAAAGAAGGTTGTTATCGAAAGCATATACAAGGAGTCGGAAGAG
GCGAAACATAATGTTAATGTGTTTATGCATGCCAATTCTTTGGCTGAGGCTCGACCTCTGTTGAAACGGGTGCAT
GGTACTCGATTCACAGAGAAATATCTACAGTCAAGGCAGCATCTCTCACGTCACTCATACCCTTACGGTTCATTG
TATACACCCTCGCGTTCACCACCGCCCAAAATCAAACCCTTACCCTTCTCACGATCTCCGCCATCATCACCACCG
CGTAAAGTCGTCAGTGATTTCGCGCCGTTCGGGGCTCCGAAGAATTCTAGCGTGTTTGGTACGGCAGTTCAGTCA
ACGCCTTTCTCACTCGCCGGCGGGAAAGCCGCTTTCGGTGCTATAAGGCCCGGTGCTGCGAAGACAGGGTTTGAC
GATGATGACGATGACGATGATTCAATGCCGCAACGGGTAGAATTACGAGAAGGCTCAATTTCGCTTGAACAGGCA
AAACGGATTGCGATGCAAAGTGCTTGGCGAAGTGCCCCAACACATGGATAG
Gene >AgabiH97|103370
ATGCGTTCAGGCACGCGATACAAAGTGAACAAGAGTCAGCATTTTGCTCAGCATGTGGTAGATGAAGTACTTAAG
TCTTTCTATCACAAGTCTATATTTAGGAGCTGGATCACGTGAGAGAATGGAGGACGACTGCCGATGGAATTCGTG
TCGTCGCTCAATTCTCTTTTTCACCGACTCCCGCTGCCATCGACTTTCAACTCCGGGAAATGAGGCGAGATGTAC
GCATTCTCCTCGTCGGCGATGGTCAGTTCTGTTTCCTCTGTCTCTTCGCCAAGTCCGACTCACGCACGCGAGCAG
AGGGTGTAGGCAAGAGCACCATCATCACGTCCCTAATTAAGGAATCCTTCGTCGCTCATGTACGCGTTCTAATCC
TCTACTACTCTCGGATTTCTACATCACTCTCAGGTTCAACATGTTGTTCCCGAGGTTACAATTCCTCCGGAGGTC
ACTCCGGAAAACGTCACGACCTACATCGTCGATTCGGGAGGTGAGTCTCCTTTCGTCTCCTGACTAGCACAACTT
GCTGACCTTTGTATCCTATCTCGCCAGCCGGACCGCAGGACCGTGCGCATCTCGAATCCGAAATCAGAAAAGCGC
ATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACCTACTGGTTACCGCACT
TCCGCCAACTTGGTGTTAACGTAATATCCTTCTTCGTATCCAGTGCTCATGCTCAAGACGGCCAATAGGTCCCTG
TTATCCTCATTGGCAATAAAATCGACTTGCGTGGCGGAGAGGTTACCAACGAGGCACTGGAGGATGAGATTGTTC
CTATTATGAACGAGTTTAAGGTTCGTTTGACCCGCTGCGTTTACGCGTGATAACCAAATTTGATCCTTAATTTTG
GCGTGAAGGAAGTAGAAACTTGCGTCGAGTGTTCCGCCAAACTTCCCCTCAACGTTTCTGAAGTCTTCTATTTTG
CTCAGAAGGCTGTTTTACATCCTACAGCACCCCTCTATGATTCTCGCGATCATGTCCGTACTCCTTTCATTCGCT
TGCCGGATCTAACATCTCACCACCTTAATCAGGTCCTCAAGCCTGCATGTGTAGCGGCACTACGTCGAATATTTA
AAATTTGCGACACAAATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAGGTATGTTTGGTAGACC
TCTTTTCAGATCTCGCTTTTTGATGAAATCTGCGTCGAAATTAGCGTAAATGTTTCGATGCCCCTCTACAGCTAC
AAGAACTCGAAGGCATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGATGAGGGCCTAACTGAAG
CTGGTTTCTTATATCTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGGACTGTGTTACGCAAAT
TCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGGTACGTGTACTATAATACCTGTAACG
AATTCCAAAGGAACCCTGTAAATTTTTATTTACCTAGATTTGACGTTCCTTCGGATTGCTCTGTTGAACTGAGTC
CATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAAGTAAGTTGGTTTGCCCTAACTAGGCGAT
TTATTGTTTCTTATTCCTGTGCCTAGGATCAGGATGGCGCCCTCAAGATCGACGAGTTGGATGAAGTTTTCAGTA
CATCGCCCGGTAATCCTTGGGCAACGCAAAAGTTTCCTGACACGACATTGTCTGATGACACGGGCGCTGTGACAT
TACAGGGGTGGTTAGCCCAATGGAGGTGTGTCTTCCCAAAGTTTGATCTAGAATTTCTTATTCATAGCACATGAG
GCAGTATGACAACACTCTTGGACCACAAAATCACGCTCGCATATCTAGCGTATTTGGGCTACCCTGGTGAATCAC
AGACCGAAGCATTACAAGTGACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTTACGCGAAATGTCTTTT
TGTGTTATGTTTGTGGTGCAGCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCAGGGAAGCCTTATAACC
CCGCGTACGAGCCCACGAGTAAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGGTCAGAAAAGTACTTGG
TGGTTAGTGTTCCTATTGGGTTGAGTGTGCGTTGCGATTGACAATTTTCTCCTAGCTGCAAGAGTTTGGATCACG
TTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTTTACGTGCACGACTCGAG
CGACACAAATTCGTTTTCATATATCAGCAACCTACGGGTGAGTGGACAAGTATAGCAGCTAATCGGGGGATGCTC
ATTGAGTGAATGTAGCAACAATATAGTTTGGACCATATACCCACACTTTTCGTGGCAACGAAGTCTGATTTGGAC
CTAGCGTTACAGGTGAGGATATTTTAACCGGAAATGGGAAGGGTCTATTGATCTACGCGTGTCCAGCGGCATGAA
GTGCAACCAGATGTGTATTGCAGACGATTAAGCCTGCAAGTGCCCGTGTCCGTCAGTGTCAAGGATGGACAATTG
GCAGACGTGTTTCATACTATTTGCAGAATAGCGATGAACCCGTAAGTAGCCCACGTTTTTCTGCAGGCGTTTCTG
ATGAGGTGTGTGTATTTAGTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACACCAGCCGCGAGGCTAA
GGATGTATTTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTATTTCGGAATGTACGGA
CACCGCTAGGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGCGGTAGACGGTAGACGG
TAGTATAATAGATTGTACTTGGATTTCCTCGTGGCGGCCTCGTTGAGGGCAGATATCCGGTAGAGTCCGAAAGAG
GACAGAGTTGTGGAGACTCTGACTTTAAAAGTCTGACCTGCGCTGATCCATCTCTCCATCGATCCCTCTCTCCCA
AACAAGCCATGGACATCGACCCGGTTACTGAGGTCAGTGAGCAGCCGCCTCTCTCCCACCTCAGGACGGCCGCCG
ACGAGGATAGAAAGATGCTGTAAGTCAATCAACACCACTTACCCACCAACTGCACACCACTCCTCTTCTACACAC
TCTCCTCTCGTTGAACCCTCTTACACCTCTCAGGGACCTCGTCTTTATCCAGGACTGCACCGGCAGCCAGGGATC
CTACATCACATCTGCAACAAAGAACATCGAGGCCATCTGTGCTTATATCTTCGAGTCTGGCAAACTCCAGTACCA
AGACGATTTGAGGGTCGGTCTGGTCGCTTTTCGAGACCATCCGCCACAGGATCATACATACATCACCAAGAACTT
TGGCTTTTCATCAGACATTAGCAAAGTTCATAAAGACCTTTCGACCTTGTATGCTTCAGGCGGTGGAGATGGTCC
TGAAGCTATCACTGCAGCTCTTGCTGATGCCTTGCACATGGATTGGAGGGAAGGAGCAACCAAGATGATTGTCCT
TATTGCTGACGCACCTCCACATGGTATTGGCGAGTATGGCGATGGTAACGTGTCCCTTTGAATCAACTGTTCTAC
TCAGATTTGATGATTGTATGTTTCTCTAGGTTTTGACGATGGATCACCAGATGGTTATGATCCACTGACTCTTGT
CAGGATCATGGCGACTAAGGGTATTACGCTGGTAAGCTTAATTTTGAAATCGCGACCTTGTGGAGCCACAAGCGA
ATTGAATTCATCAGTTCTTTGTGGCTTGTGAACCTGCACTCAGTGGTTACTCGGTATGTTTGATCTACGTGGTAC
GTTTTCACCGCTGAAATACTGACTAAGAAATATCAGTATGCTACGGATTTCTATCAAGCGATAACCAACATCACT
TCTGGATTGATGCTCCCGCTCACAACTGCCGACCTCCTCGCACATGCTATTGTTGGTAGCGTGCTAGAGAACCTG
GATATGGAACGACTTGTTCTAGAAGTTGGTGCTGCTGTCGCGGAACGTATTCATGGAAACCACGAGAGCGTCGAT
GATGTGGCCCGTGAACTGCACGAGAGGCTTTTGTTGCGGAATGAAAACACAAAGAAGGTTGTTATCGAAAGCATA
TACAAGGAGTCGGAAGAGGCGAAACATAATGTTAATGTGTTTATGCATGCCAATTCTTTGGCTGAGGCTCGACCT
CTGTTGAAACGGGTAAGTTATCCCGGTTCTACTCCTTTGCGTTTGTAATCACGACTCGTCTGTTGTTAGGTGCAT
GGTACTCGATTCACAGAGAAATATCTACAGTCAAGGCAGCATCTCTCACGTCACTCATACCCTTACGGTTCATTG
TATACACCCTCGCGTTCACCACCGCCCAAAATCAAACCCTTACCCTTCTCACGATCTCCGCCATCATCACCACCG
CGTAAAGTCGTCAGTGATTTCGCGCCGTTCGGGGCTCCGAAGAATTCTAGCGTGTTTGGTACGGCAGTTCAGTCA
ACGCCTTTCTCACTCGCCGGCGGGAAAGCCGCTTTCGGTGCTATAAGGCCCGGTGCTGCGAAGACAGGGTTTGAC
GATGATGACGATGACGATGATTCAATGCCGCAACGGGTAGAATTACGAGAAGGCTCAATTTCGCTTGAACAGGTG
ACTATTATCTAGTCCTTTTGCTATCATGGATTGATGTACTTAATTGGTTCATAGGCAAAACGGATTGCGATGCAA
AGTGCTTGGCGAAGTGCCCCAACACATGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail