Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103360
Gene name
Locationscaffold_7:1584455..1586172
Strand-
Gene length (bp)1717
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.7E-05 6 40
PF00646 F-box F-box domain 2.9E-04 5 39

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5036 0.5416 0.0284 0.0202 0.2563 0.0614 0.2473 0.2221 0.2894 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 38.47 22.69 54.25
Initials Initials knots 40.68 24.15 57.21
Pileal_Stipeal_center Stage I stipe center 34.90 20.32 49.48
Pileal_Stipeal_shell Stage I stipe shell 39.49 23.47 55.51
DIF_stipe_center Stage II stipe center 35.66 20.82 50.51
DIF_stipe_shell Stage II stipe shell 45.52 27.16 63.89
DIF_stipe_skin Stage II stipe skin 40.55 24.03 57.07
DIF_cap_skin Stage II cap skin 37.13 21.87 52.38
DIF_cap_tissue Stage II cap tissue 46.37 27.62 65.12
DIF_gill_tissue Stage II gill tissue 43.37 25.78 60.96
YFB_stipe_center Young fruiting body stipe center 37.52 22.08 52.97
YFB_stipe_shell Young fruiting body stipe shell 42.57 25.01 60.13
YFB_stipe_skin Young fruiting body stipe skin 36.37 21.27 51.47
YFB_cap_skin Young fruiting body cap skin 23.90 13.46 34.34
YFB_cap_tissue Young fruiting body cap tissue 26.55 15.17 37.94
YFB_gill_tissue Young fruiting body gill tissue 32.49 19.00 45.98
YFB_veil Young fruiting body veil 41.60 24.16 59.03

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.791758 no
Casing YFB_stipe_center 0.964907 no
Casing YFB_stipe_shell 0.833543 no
Casing YFB_stipe_skin 0.916488 no
Casing YFB_cap_skin 0.113966 no
Casing YFB_cap_tissue 0.246388 no
Casing YFB_gill_tissue 0.691322 no
Casing YFB_veil 0.879110 no
Casing Initials 0.915400 no
Casing Pileal_Stipeal_center 0.843154 no
Casing Pileal_Stipeal_shell 0.963395 no
Casing DIF_stipe_center 0.883204 no
Casing DIF_stipe_shell 0.676375 no
Casing DIF_stipe_skin 0.922276 no
Casing DIF_cap_skin 0.949986 no
Casing DIF_cap_tissue 0.647770 no
DIF_gill_tissue YFB_stipe_center 0.739428 no
DIF_gill_tissue YFB_stipe_shell 0.973789 no
DIF_gill_tissue YFB_stipe_skin 0.659480 no
DIF_gill_tissue YFB_cap_skin 0.032038 yes
DIF_gill_tissue YFB_cap_tissue 0.091161 no
DIF_gill_tissue YFB_gill_tissue 0.403699 no
DIF_gill_tissue YFB_veil 0.939205 no
YFB_stipe_center YFB_stipe_shell 0.780218 no
YFB_stipe_center YFB_stipe_skin 0.955931 no
YFB_stipe_center YFB_cap_skin 0.133562 no
YFB_stipe_center YFB_cap_tissue 0.284448 no
YFB_stipe_center YFB_gill_tissue 0.745186 no
YFB_stipe_center YFB_veil 0.829174 no
YFB_stipe_shell YFB_stipe_skin 0.710717 no
YFB_stipe_shell YFB_cap_skin 0.042909 yes
YFB_stipe_shell YFB_cap_tissue 0.112257 no
YFB_stipe_shell YFB_gill_tissue 0.448054 no
YFB_stipe_shell YFB_veil 0.967921 no
YFB_stipe_skin YFB_cap_skin 0.174631 no
YFB_stipe_skin YFB_cap_tissue 0.354920 no
YFB_stipe_skin YFB_gill_tissue 0.812559 no
YFB_stipe_skin YFB_veil 0.763782 no
YFB_cap_skin YFB_cap_tissue 0.838617 no
YFB_cap_skin YFB_gill_tissue 0.395048 no
YFB_cap_skin YFB_veil 0.055583 no
YFB_cap_tissue YFB_gill_tissue 0.623270 no
YFB_cap_tissue YFB_veil 0.137029 no
YFB_gill_tissue YFB_veil 0.512152 no
Initials DIF_gill_tissue 0.901863 no
Initials YFB_stipe_center 0.875835 no
Initials YFB_stipe_shell 0.934639 no
Initials YFB_stipe_skin 0.808850 no
Initials YFB_cap_skin 0.066767 no
Initials YFB_cap_tissue 0.163031 no
Initials YFB_gill_tissue 0.558964 no
Initials YFB_veil 0.968999 no
Initials Pileal_Stipeal_center 0.725524 no
Initials Pileal_Stipeal_shell 0.958575 no
Initials DIF_stipe_center 0.766813 no
Initials DIF_stipe_shell 0.804889 no
Initials DIF_stipe_skin 0.995325 no
Initials DIF_cap_skin 0.853176 no
Initials DIF_cap_tissue 0.769798 no
Pileal_Stipeal_center DIF_gill_tissue 0.566324 no
Pileal_Stipeal_center YFB_stipe_center 0.892864 no
Pileal_Stipeal_center YFB_stipe_shell 0.616889 no
Pileal_Stipeal_center YFB_stipe_skin 0.940968 no
Pileal_Stipeal_center YFB_cap_skin 0.254850 no
Pileal_Stipeal_center YFB_cap_tissue 0.456665 no
Pileal_Stipeal_center YFB_gill_tissue 0.894163 no
Pileal_Stipeal_center YFB_veil 0.674137 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.788198 no
Pileal_Stipeal_center DIF_stipe_center 0.970213 no
Pileal_Stipeal_center DIF_stipe_shell 0.450318 no
Pileal_Stipeal_center DIF_stipe_skin 0.728233 no
Pileal_Stipeal_center DIF_cap_skin 0.909006 no
Pileal_Stipeal_center DIF_cap_tissue 0.425676 no
Pileal_Stipeal_shell DIF_gill_tissue 0.846349 no
Pileal_Stipeal_shell YFB_stipe_center 0.926950 no
Pileal_Stipeal_shell YFB_stipe_shell 0.885257 no
Pileal_Stipeal_shell YFB_stipe_skin 0.870259 no
Pileal_Stipeal_shell YFB_cap_skin 0.088613 no
Pileal_Stipeal_shell YFB_cap_tissue 0.204585 no
Pileal_Stipeal_shell YFB_gill_tissue 0.628068 no
Pileal_Stipeal_shell YFB_veil 0.925042 no
Pileal_Stipeal_shell DIF_stipe_center 0.831817 no
Pileal_Stipeal_shell DIF_stipe_shell 0.740948 no
Pileal_Stipeal_shell DIF_stipe_skin 0.963467 no
Pileal_Stipeal_shell DIF_cap_skin 0.908374 no
Pileal_Stipeal_shell DIF_cap_tissue 0.707042 no
DIF_stipe_center DIF_gill_tissue 0.611253 no
DIF_stipe_center YFB_stipe_center 0.928873 no
DIF_stipe_center YFB_stipe_shell 0.663447 no
DIF_stipe_center YFB_stipe_skin 0.972458 no
DIF_stipe_center YFB_cap_skin 0.199377 no
DIF_stipe_center YFB_cap_tissue 0.392818 no
DIF_stipe_center YFB_gill_tissue 0.853293 no
DIF_stipe_center YFB_veil 0.720375 no
DIF_stipe_center DIF_stipe_shell 0.487260 no
DIF_stipe_center DIF_stipe_skin 0.776570 no
DIF_stipe_center DIF_cap_skin 0.944084 no
DIF_stipe_center DIF_cap_tissue 0.456734 no
DIF_stipe_shell DIF_gill_tissue 0.928972 no
DIF_stipe_shell YFB_stipe_center 0.619792 no
DIF_stipe_shell YFB_stipe_shell 0.898073 no
DIF_stipe_shell YFB_stipe_skin 0.539534 no
DIF_stipe_shell YFB_cap_skin 0.017226 yes
DIF_stipe_shell YFB_cap_tissue 0.056958 no
DIF_stipe_shell YFB_gill_tissue 0.302307 no
DIF_stipe_shell YFB_veil 0.854523 no
DIF_stipe_shell DIF_stipe_skin 0.800559 no
DIF_stipe_shell DIF_cap_skin 0.589625 no
DIF_stipe_shell DIF_cap_tissue 0.973534 no
DIF_stipe_skin DIF_gill_tissue 0.896039 no
DIF_stipe_skin YFB_stipe_center 0.881180 no
DIF_stipe_skin YFB_stipe_shell 0.929298 no
DIF_stipe_skin YFB_stipe_skin 0.815535 no
DIF_stipe_skin YFB_cap_skin 0.070499 no
DIF_stipe_skin YFB_cap_tissue 0.169443 no
DIF_stipe_skin YFB_gill_tissue 0.568043 no
DIF_stipe_skin YFB_veil 0.963395 no
DIF_stipe_skin DIF_cap_skin 0.858362 no
DIF_stipe_skin DIF_cap_tissue 0.765260 no
DIF_cap_skin DIF_gill_tissue 0.711051 no
DIF_cap_skin YFB_stipe_center 0.984774 no
DIF_cap_skin YFB_stipe_shell 0.756812 no
DIF_cap_skin YFB_stipe_skin 0.970366 no
DIF_cap_skin YFB_cap_skin 0.153274 no
DIF_cap_skin YFB_cap_tissue 0.307771 no
DIF_cap_skin YFB_gill_tissue 0.767794 no
DIF_cap_skin YFB_veil 0.807896 no
DIF_cap_skin DIF_cap_tissue 0.555386 no
DIF_cap_tissue DIF_gill_tissue 0.898555 no
DIF_cap_tissue YFB_stipe_center 0.580751 no
DIF_cap_tissue YFB_stipe_shell 0.866962 no
DIF_cap_tissue YFB_stipe_skin 0.503319 no
DIF_cap_tissue YFB_cap_skin 0.017226 yes
DIF_cap_tissue YFB_cap_tissue 0.050085 no
DIF_cap_tissue YFB_gill_tissue 0.283656 no
DIF_cap_tissue YFB_veil 0.820498 no

Orthologs

Orthofinder run ID1
Orthogroup4909
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|103360
Agaricus bisporus var bisporus H97 AgabiH97|103360 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|77_8

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103360
MTQMFTNLPNDVLICIFQFLSPVELAHLSLACSVLYHLVNEYGWSAYLRSHIRPSQSLSRARARWPARLRAKYDY
LTDEAWHNNSFVARPLSHPWQGKSSPLLIISQNRLIVASGTTLHSFTFGTSGDESNTSPPVSFEASFSLSSEHSP
CKEITGVTLVSSDGSNDVLFVAFQDSVIERISISASDGITPPSITRHHASTIPDSDPVESLSSASDLLLSLSLNG
SVKLANHRDLTSSVGLNWNSTEDLKARSWASYLCLSSSTPYAAFGTSNRSAPLPIYTLPYHQFSSSIPSLLLTSG
SRSNSPITTSSSAVYGLSQAPPSSPWGSSPQILVAGWYDSKVRCYDLRTPTSSSIPFQSSDSLNGTPSSSLVSVP
ALNPVLSLHNPWSYEPIYSVSCGGGSGSFIAAGAARHSVLSFWDIRSPKGGWSVHAPGNDTSPVYSVILESSRCF
GATERRPFVYDFGPGVIIDTYPPITRVRGDKLKFEKSSGRKGVDYYVTKYPHSRGNIFIDH*
Coding >AgabiH97|103360
ATGACTCAAATGTTCACAAATCTACCCAACGACGTCCTCATTTGCATATTTCAATTCTTGTCCCCGGTCGAGCTC
GCCCATCTTTCCCTGGCATGCAGTGTTCTGTATCATTTGGTCAATGAATACGGCTGGTCTGCCTACCTACGCTCG
CACATAAGGCCTTCCCAAAGCCTTTCCCGTGCCAGAGCGCGCTGGCCGGCGCGACTCCGCGCCAAATACGATTAC
CTCACCGATGAAGCCTGGCACAACAATTCTTTCGTCGCAAGGCCGCTATCTCACCCTTGGCAGGGCAAGAGTTCT
CCACTCCTTATCATTTCACAGAACCGCCTCATCGTTGCTTCGGGGACTACCCTCCATTCTTTCACATTCGGTACA
TCTGGTGATGAATCAAATACTTCCCCACCCGTCTCCTTCGAGGCCTCATTCTCTCTATCGAGTGAACATTCGCCT
TGTAAAGAGATCACTGGCGTTACTCTGGTTTCTTCCGATGGCTCCAATGACGTTCTTTTTGTTGCTTTCCAAGAC
AGCGTTATAGAACGCATCTCCATTTCAGCATCGGATGGTATCACCCCACCCAGCATCACCCGTCACCACGCTAGT
ACAATACCCGATAGTGACCCTGTCGAAAGTCTCTCATCTGCCTCTGATCTTCTATTATCGCTATCTCTCAATGGA
TCCGTTAAACTCGCAAATCACCGTGATTTAACCTCTTCTGTAGGGCTTAATTGGAATTCCACAGAAGATCTCAAA
GCACGTAGCTGGGCGTCGTACCTGTGTCTTTCGTCTTCCACTCCCTATGCTGCATTCGGAACCTCCAATCGCTCT
GCACCACTTCCCATCTATACTCTACCTTACCACCAATTCTCATCCTCTATACCATCCTTGCTTCTCACATCCGGA
TCAAGATCTAATTCTCCCATAACCACATCTTCTTCCGCTGTCTACGGACTCTCTCAAGCACCTCCTTCTTCTCCC
TGGGGTTCTTCACCTCAAATTCTAGTTGCCGGTTGGTACGATAGTAAAGTTCGGTGTTATGATCTCCGCACTCCA
ACTTCGTCCTCTATCCCCTTCCAATCCTCCGACTCCCTTAACGGTACACCATCGTCATCATTGGTGAGCGTGCCA
GCGCTCAATCCAGTACTTTCACTCCATAATCCTTGGTCATATGAACCCATATATTCTGTCTCCTGCGGTGGTGGT
TCAGGAAGTTTTATCGCTGCAGGTGCTGCACGTCATAGCGTACTCTCTTTTTGGGATATCCGATCTCCGAAAGGA
GGATGGAGCGTACATGCTCCAGGAAATGATACTTCACCCGTTTATTCAGTCATTCTTGAAAGTTCAAGGTGTTTT
GGAGCTACGGAACGTCGACCCTTTGTTTATGATTTCGGACCTGGCGTGATTATCGATACATACCCACCTATCACG
CGTGTGCGAGGTGATAAGCTCAAATTTGAAAAATCATCCGGTCGGAAAGGCGTTGATTACTACGTGACGAAATAC
CCTCATAGCCGAGGAAATATATTTATCGATCATTGA
Transcript >AgabiH97|103360
ATGACTCAAATGTTCACAAATCTACCCAACGACGTCCTCATTTGCATATTTCAATTCTTGTCCCCGGTCGAGCTC
GCCCATCTTTCCCTGGCATGCAGTGTTCTGTATCATTTGGTCAATGAATACGGCTGGTCTGCCTACCTACGCTCG
CACATAAGGCCTTCCCAAAGCCTTTCCCGTGCCAGAGCGCGCTGGCCGGCGCGACTCCGCGCCAAATACGATTAC
CTCACCGATGAAGCCTGGCACAACAATTCTTTCGTCGCAAGGCCGCTATCTCACCCTTGGCAGGGCAAGAGTTCT
CCACTCCTTATCATTTCACAGAACCGCCTCATCGTTGCTTCGGGGACTACCCTCCATTCTTTCACATTCGGTACA
TCTGGTGATGAATCAAATACTTCCCCACCCGTCTCCTTCGAGGCCTCATTCTCTCTATCGAGTGAACATTCGCCT
TGTAAAGAGATCACTGGCGTTACTCTGGTTTCTTCCGATGGCTCCAATGACGTTCTTTTTGTTGCTTTCCAAGAC
AGCGTTATAGAACGCATCTCCATTTCAGCATCGGATGGTATCACCCCACCCAGCATCACCCGTCACCACGCTAGT
ACAATACCCGATAGTGACCCTGTCGAAAGTCTCTCATCTGCCTCTGATCTTCTATTATCGCTATCTCTCAATGGA
TCCGTTAAACTCGCAAATCACCGTGATTTAACCTCTTCTGTAGGGCTTAATTGGAATTCCACAGAAGATCTCAAA
GCACGTAGCTGGGCGTCGTACCTGTGTCTTTCGTCTTCCACTCCCTATGCTGCATTCGGAACCTCCAATCGCTCT
GCACCACTTCCCATCTATACTCTACCTTACCACCAATTCTCATCCTCTATACCATCCTTGCTTCTCACATCCGGA
TCAAGATCTAATTCTCCCATAACCACATCTTCTTCCGCTGTCTACGGACTCTCTCAAGCACCTCCTTCTTCTCCC
TGGGGTTCTTCACCTCAAATTCTAGTTGCCGGTTGGTACGATAGTAAAGTTCGGTGTTATGATCTCCGCACTCCA
ACTTCGTCCTCTATCCCCTTCCAATCCTCCGACTCCCTTAACGGTACACCATCGTCATCATTGGTGAGCGTGCCA
GCGCTCAATCCAGTACTTTCACTCCATAATCCTTGGTCATATGAACCCATATATTCTGTCTCCTGCGGTGGTGGT
TCAGGAAGTTTTATCGCTGCAGGTGCTGCACGTCATAGCGTACTCTCTTTTTGGGATATCCGATCTCCGAAAGGA
GGATGGAGCGTACATGCTCCAGGAAATGATACTTCACCCGTTTATTCAGTCATTCTTGAAAGTTCAAGGTGTTTT
GGAGCTACGGAACGTCGACCCTTTGTTTATGATTTCGGACCTGGCGTGATTATCGATACATACCCACCTATCACG
CGTGTGCGAGGTGATAAGCTCAAATTTGAAAAATCATCCGGTCGGAAAGGCGTTGATTACTACGTGACGAAATAC
CCTCATAGCCGAGGAAATATATTTATCGATCATTGA
Gene >AgabiH97|103360
ATGACTCAAGTAGGTTTACTTCAAAGCCCCGACAGCGGGGACGTTAGGTTCGCCTAGCTTAATTTTCACAGATGT
TCACAAATCTACCCAACGACGTCCTCATTTGCATATTTCAATTCTTGTCCCCGGTCGAGCTCGCCCATCTTTCCC
TGGCATGCAGTGTTCTGTATCATTTGGTGCGTCCTACGTCTCCACCTATCAGTGAATGGTACTACATCTATCGTC
AGGTCAATGAATACGGCTGGTCTGCCTACCTACGCTCGCACATAAGGCCTTCCCAAAGCCTTTCCCGTGCCAGAG
CGCGCTGGCCGGCGCGACTCCGCGCCAAATACGATTACCTCACCGATGAAGCCTGGCACAACAATTCTTTCGTCG
CAAGGCCGCTATCTCACCCTTGGCAGGGCAAGAGTTCTCCACTCCTTATCATTTCACAGAACCGCCTCATCGTTG
CTTCGGGGACTACCCTCCATTCTTTCACATTCGGTACATCTGGTGATGAATCAAATACTTCCCCACCCGTCTCCT
TCGAGGCCTCATTCTCTCTATCGAGTGAACATTCGCCTTGTAAAGAGATCACTGGCGTTACTCTGGTTTCTTCCG
ATGGCTCCAATGACGTTCTTTTTGTTGCTTTCCAAGACAGCGTTATAGAACGCATCTCCATTTCAGCATCGGATG
GTATCACCCCACCCAGCATCACCCGTCACCACGCTAGTACAATACCCGATAGTGACCCTGTCGAAAGTCTCTCAT
CTGCCTCTGATCTTCTATTATCGCTATCTCTCAATGGATCCGTTAAACTCGCAAATCACCGTGATTTAACCTCTT
CTGTAGGGCTTAATTGGAATTCCACAGAAGATCTCAAAGCACGTAGCTGGGCGTCGTACCTGTGTCTTTCGTCTT
CCACTCCCTATGCTGCATTCGGAACCTCCAATCGCTCTGCACCACTTCCCATCTATACTCTACCTTACCACCAAT
TCTCATCCTCTATACCATCCTTGCTTCTCACATCCGGATCAAGATCTAATTCTCCCATAACCACATCTTCTTCCG
CTGTCTACGGACTCTCTCAAGCACCTCCTTCTTCTCCCTGGGGTTCTTCACCTCAAATTCTAGTTGCCGGTTGGT
ACGATAGTAAAGTTCGGTGTTATGATCTCCGCACTCCAACTTCGTCCTCTATCCCCTTCCAATCCTCCGACTCCC
TTAACGGTACACCATCGTCATCATTGGTGAGCGTGCCAGCGCTCAATCCAGTACTTTCACTCCATAATCCTTGGT
CATATGAACCCATATATTCTGTCTCCTGCGGTGGTGGTTCAGGAAGTTTTATCGCTGCAGGTGCTGCACGTCATA
GCGTACTCTCTTTTTGGGATATCCGATCTCCGAAAGGAGGATGGAGCGTACATGCTCCAGGAAATGATACTTCAC
CCGTTTATTCAGTCATTCTTGAAAGTTCAAGGTGTTTTGGAGCTACGGAACGTCGACCCTTTGTTTATGATTTCG
TGAGTTGACTTATCTTTCTCTTTCTTTTTCCTTATCGAATGCGACACGATTCTAATTTTCTTCTTAGGGACCTGG
CGTGATTATCGATACATACCCACCTATCACGCGTGTGCGAGGTGATAAGCTCAAATTTGAAAAATCATCCGGTCG
GAAAGGCGTTGATTACTACGTGACGAAATACCCTCATAGCCGAGGAAATATATTTATCGATCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail