Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103340
Gene name
Locationscaffold_7:1576334..1577690
Strand-
Gene length (bp)1356
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.9E-24 38 180
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.0E-14 47 198
PF08659 KR KR domain 2.6E-07 41 156
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.5E-06 41 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 2 302 8.0E-49
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 34 310 5.0E-39
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 18 310 2.0E-37
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 34 310 2.0E-37
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 34 274 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 2 302 8.0E-49
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 34 310 5.0E-39
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 18 310 2.0E-37
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 34 310 2.0E-37
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 34 274 3.0E-37
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 34 310 3.0E-36
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 28 318 1.0E-35
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 17 293 7.0E-34
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 17 319 3.0E-33
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 17 319 4.0E-33
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 17 319 1.0E-32
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 16 311 2.0E-32
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 28 312 5.0E-32
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 32 310 1.0E-31
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 35 317 1.0E-31
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 32 310 3.0E-31
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 34 310 1.0E-30
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 35 310 2.0E-29
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 35 317 2.0E-29
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 17 319 3.0E-29
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 35 311 5.0E-29
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 5 311 7.0E-26
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 34 287 5.0E-25
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 33 319 4.0E-20
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 34 249 3.0E-19
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 37 244 4.0E-19
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 34 249 6.0E-19
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 35 249 1.0E-18
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 26 245 2.0E-18
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 40 312 2.0E-17
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 41 269 6.0E-16
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 41 269 4.0E-15
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 28 277 8.0E-15
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 35 320 4.0E-14
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 40 263 5.0E-14
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 23 269 5.0E-14
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 39 312 5.0E-14
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 35 320 4.0E-13
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 38 312 4.0E-13
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 41 263 1.0E-12
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 35 219 1.0E-12
sp|Q59987|POR_SYNY3 Light-dependent protochlorophyllide reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=por PE=3 SV=2 41 249 3.0E-12
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 40 263 3.0E-12
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 41 249 3.0E-12
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 34 226 4.0E-12
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 34 244 8.0E-11
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 34 244 8.0E-11
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 34 244 2.0E-10
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 35 257 2.0E-10
sp|Q5AV81|Y7799_EMENI Uncharacterized oxidoreductase AN7799 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7799 PE=1 SV=2 42 246 3.0E-10
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 32 246 3.0E-10
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 9 174 7.0E-10
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 34 180 7.0E-10
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 35 257 8.0E-10
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 38 260 1.0E-09
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 35 257 2.0E-09
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 35 204 2.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 35 300 2.0E-09
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 34 250 4.0E-09
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 34 250 4.0E-09
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 33 246 4.0E-09
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 32 246 4.0E-09
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 32 199 5.0E-09
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 32 276 5.0E-09
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 35 199 9.0E-09
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 32 152 1.0E-08
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 37 250 1.0E-08
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 37 250 1.0E-08
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 32 251 1.0E-08
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 32 251 1.0E-08
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 32 251 1.0E-08
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 32 251 1.0E-08
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 32 251 1.0E-08
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 32 251 2.0E-08
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 32 251 2.0E-08
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 34 244 2.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 35 199 2.0E-08
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 35 147 2.0E-08
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 34 250 3.0E-08
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 35 152 3.0E-08
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 94 263 3.0E-08
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 35 263 4.0E-08
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 35 189 4.0E-08
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 94 263 4.0E-08
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 35 211 5.0E-08
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 35 246 6.0E-08
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 32 290 6.0E-08
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 35 199 6.0E-08
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 31 252 7.0E-08
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 35 246 7.0E-08
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 19 246 7.0E-08
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 35 179 8.0E-08
sp|O88736|DHB7_MOUSE 3-keto-steroid reductase OS=Mus musculus GN=Hsd17b7 PE=1 SV=1 38 260 8.0E-08
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 32 250 9.0E-08
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 32 250 9.0E-08
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 35 199 9.0E-08
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 32 251 9.0E-08
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 34 250 1.0E-07
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 38 149 1.0E-07
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 34 152 2.0E-07
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 34 190 2.0E-07
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 38 250 2.0E-07
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 35 152 2.0E-07
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 33 155 2.0E-07
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 21 204 2.0E-07
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 35 152 2.0E-07
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 35 199 2.0E-07
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 31 182 3.0E-07
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 38 147 3.0E-07
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 39 161 3.0E-07
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 39 161 3.0E-07
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 35 147 3.0E-07
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 35 211 4.0E-07
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 28 257 4.0E-07
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 15 182 5.0E-07
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 34 244 5.0E-07
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 35 147 5.0E-07
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 32 255 5.0E-07
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 34 244 6.0E-07
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 34 162 6.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 33 157 7.0E-07
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 33 155 7.0E-07
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 35 211 7.0E-07
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 35 152 7.0E-07
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 11 164 7.0E-07
sp|Q62904|DHB7_RAT 3-keto-steroid reductase OS=Rattus norvegicus GN=Hsd17b7 PE=1 SV=1 38 260 7.0E-07
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 35 155 9.0E-07
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 33 159 9.0E-07
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 15 164 9.0E-07
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 35 147 1.0E-06
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 33 155 1.0E-06
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 34 180 1.0E-06
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 34 244 1.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 35 199 1.0E-06
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 34 245 1.0E-06
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 35 147 1.0E-06
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 35 246 1.0E-06
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 32 251 1.0E-06
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 39 161 1.0E-06
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 33 134 1.0E-06
sp|Q071N0|SALR_PAPSO Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 38 178 2.0E-06
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 38 178 2.0E-06
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 39 161 2.0E-06
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 34 128 2.0E-06
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 29 179 2.0E-06
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 33 155 2.0E-06
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 35 289 2.0E-06
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 35 198 2.0E-06
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 35 257 3.0E-06
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 35 246 3.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 39 179 3.0E-06
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 39 179 3.0E-06
sp|P19871|3BHD_COMTE 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 35 128 3.0E-06
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 34 190 3.0E-06
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 35 246 3.0E-06
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 30 199 3.0E-06
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 35 246 3.0E-06
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 35 246 3.0E-06
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 41 246 3.0E-06
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 32 163 4.0E-06
sp|Q7XKF3|PORA_ORYSJ Protochlorophyllide reductase A, chloroplastic OS=Oryza sativa subsp. japonica GN=PORA PE=2 SV=1 25 263 4.0E-06
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 32 145 4.0E-06
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 34 190 4.0E-06
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 35 185 4.0E-06
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 37 248 4.0E-06
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 39 161 4.0E-06
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 39 247 4.0E-06
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 32 181 5.0E-06
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 34 190 5.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 16 199 5.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 24 199 5.0E-06
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 32 250 6.0E-06
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 32 250 6.0E-06
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 35 125 6.0E-06
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 34 204 7.0E-06
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 32 187 7.0E-06
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 35 125 7.0E-06
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 35 257 7.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 41 262 8.0E-06
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 35 244 8.0E-06
sp|P08694|BPHB_PSEPS Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas pseudoalcaligenes GN=bphB PE=3 SV=2 35 211 8.0E-06
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 36 245 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103340
MGFLADLCAIDFVSSFKQTFFLPRATWTAEDMPDLSGKVAIVTGGNSGIGKEVAKALLAHNAKVYIGCRSKERAE
RAILDLKEATGKEAIFLPLDLASLGRVKDAAMQFANKEKELHLLINNAGVMFPPHSQLSEGYDTQFHTNVTGHWY
LTTLLLPILSETVKHSPPKSVRVVHVSSVGHYGAKAQPLNFASFKDGVVRNRYFTHELYMQSKFGNIVVANEFHR
RYAEQGLVSISVHPGTINTELYRHFRVPLLPSLVLYPPKTGAITPLHAATAKDAGHYGGKYLFPWARTGKARPDT
DDPKLGKDLWTWLEEQVKDT*
Coding >AgabiH97|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTCAAGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGGCAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGCTTTGTTGGCGCATAATGCCAAGGTGTATATCGGGTGTCGAAGCAAGGAACGAGCGGAA
CGCGCAATTCTAGATTTGAAGGAGGCAACGGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGTTTGGGA
CGCGTAAAAGATGCTGCGATGCAGTTTGCCAACAAAGAGAAGGAGCTGCACTTGTTGATAAACAATGCTGGCGTC
ATGTTTCCTCCTCATTCTCAACTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCGGTCACTGGTAT
CTCACAACATTGCTGTTACCAATCTTGTCTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCAC
GTCTCTTCCGTTGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTCGCTAGTTTCAAGGATGGAGTAGTGAGA
AACAGATATTTCACTCATGAGCTTTACATGCAGAGCAAGTTCGGTAATATCGTTGTGGCAAATGAATTCCACCGA
AGATATGCAGAACAAGGTCTGGTTTCCATTTCCGTACATCCAGGGACTATCAATACCGAGCTTTATCGTCATTTC
AGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCACACCACTTCATGCCGCTACG
GCGAAAGATGCTGGGCATTACGGCGGGAAGTACTTATTTCCGTGGGCAAGAACTGGAAAAGCTCGTCCCGACACT
GATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGATACTTGA
Transcript >AgabiH97|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTCAAGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGGCAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGCTTTGTTGGCGCATAATGCCAAGGTGTATATCGGGTGTCGAAGCAAGGAACGAGCGGAA
CGCGCAATTCTAGATTTGAAGGAGGCAACGGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGTTTGGGA
CGCGTAAAAGATGCTGCGATGCAGTTTGCCAACAAAGAGAAGGAGCTGCACTTGTTGATAAACAATGCTGGCGTC
ATGTTTCCTCCTCATTCTCAACTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCGGTCACTGGTAT
CTCACAACATTGCTGTTACCAATCTTGTCTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCAC
GTCTCTTCCGTTGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTCGCTAGTTTCAAGGATGGAGTAGTGAGA
AACAGATATTTCACTCATGAGCTTTACATGCAGAGCAAGTTCGGTAATATCGTTGTGGCAAATGAATTCCACCGA
AGATATGCAGAACAAGGTCTGGTTTCCATTTCCGTACATCCAGGGACTATCAATACCGAGCTTTATCGTCATTTC
AGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCACACCACTTCATGCCGCTACG
GCGAAAGATGCTGGGCATTACGGCGGGAAGTACTTATTTCCGTGGGCAAGAACTGGAAAAGCTCGTCCCGACACT
GATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGATACTTGA
Gene >AgabiH97|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTCAAGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGGCAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGTGTGTTTTCCGCTGCATTCTAGTTGTACTATGACGTGATTTTCAGGCTTTGTTGGCGCA
TAATGCCAAGGTGTATATCGGGTGTCGAAGCAAGGAACGAGCGGAACGCGCAATTCTAGATTTGAAGGAGGCAAC
GGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGTTTGGGACGCGTAAAAGATGCTGCGATGCAGTTTGC
CAAGTGAGCCAAACGACGTTTTCGTCAGCGCAGGTACGACTGAGTCCGCCATTTCTCAATTATAGCAAAGAGAAG
GAGCTGCACTTGTTGATAAACAATGCGTTTGTTCATTTACTCTTCCTCTTCATCTAAAATTTTTGACTCCACCAC
ATAGTGGCGTCATGTTTCCTCCTCATTCTCAACTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCG
GCGAGTAATATCAAACTTGCTGGAATAATCCAGAAGTACTCACCACACCATAGGTCACTGGTATCTCACAACATT
GCTGTTACCAATCTTGTCTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCACGTCTCTTCCGT
TGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTCGCTAGTTTCAAGGATGGAGTAGTGAGAAACAGATATTT
CACTCATGAGCTTTACATGCAGAGCAAGTTCGTAAGTAATTCTCAAGAGGAAGCTTATGGGTGACTGTTAATATC
TACATATCATCTAGGGTAATATCGTTGTGGCAAATGAATTCCACCGAAGATATGCAGAACAAGGTCTGGTTTCCA
TTTCCGTACATCCAGGTCAGTAAATCTTCCGAGCTTTCGGAATGTTTACTCATTGATCACTAGGGACTATCAATA
CCGAGCTTTATCGTCATTTCAGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCA
CACCACTTCATGCCGCTACGGCGAAAGATGCTGGGCATTACGGCGGGAAGGTGTGTTTTTGAAAAAACAACGTTG
CTCGGTTGTGCGTTATGAACATGGCCGGTCTAACCATTCCTCTTGCAGTACTTATTTCCGTGGGCAAGAACTGGA
AAAGCTCGTCCCGACACTGATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGAT
ACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail