Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103230
Gene name
Locationscaffold_7:1539504..1541576
Strand+
Gene length (bp)2072
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 8.2E-81 24 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1 321 8.0E-113
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1 315 5.0E-111
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1 300 7.0E-96
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 1 289 1.0E-90
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 1 305 7.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1 321 8.0E-113
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1 315 5.0E-111
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1 300 7.0E-96
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 1 289 1.0E-90
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 1 305 7.0E-88
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 1 308 9.0E-88
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1 287 1.0E-84
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1 289 7.0E-84
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 1 287 8.0E-83
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1 289 1.0E-79
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 1 287 2.0E-73
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 1 289 2.0E-72
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1 289 1.0E-67
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1 289 3.0E-67
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1 289 2.0E-66
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1 289 4.0E-64
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 5 291 1.0E-63
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 1 342 2.0E-61
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 1 342 6.0E-61
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 1 342 9.0E-61
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 1 342 2.0E-60
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 1 289 3.0E-59
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 1 329 2.0E-58
sp|P38089|PP2C4_YEAST Protein phosphatase 2C homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC4 PE=1 SV=1 1 311 2.0E-57
sp|O62830|PPM1B_BOVIN Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2 SV=2 1 329 2.0E-57
sp|P35815|PPM1B_RAT Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1 1 329 2.0E-57
sp|O75688|PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens GN=PPM1B PE=1 SV=1 1 329 3.0E-56
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 1 289 2.0E-55
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 117 289 7.0E-53
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 6 292 5.0E-52
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 117 289 8.0E-51
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 117 296 4.0E-50
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 117 296 5.0E-50
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 117 289 9.0E-50
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 117 308 1.0E-49
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 117 289 2.0E-49
sp|Q6K1U4|P2C16_ORYSJ Probable protein phosphatase 2C 16 OS=Oryza sativa subsp. japonica GN=Os02g0598400 PE=2 SV=1 6 297 4.0E-45
sp|A3A8Q4|P2C18_ORYSJ Probable protein phosphatase 2C 18 OS=Oryza sativa subsp. japonica GN=Os02g0599200 PE=2 SV=2 1 298 2.0E-44
sp|Q8BGL1|PPM1N_MOUSE Probable protein phosphatase 1N OS=Mus musculus GN=Ppm1n PE=2 SV=1 24 289 3.0E-43
sp|Q8N819|PPM1N_HUMAN Probable protein phosphatase 1N OS=Homo sapiens GN=PPM1N PE=2 SV=2 14 289 7.0E-43
sp|Q6K1U0|P2C17_ORYSJ Probable protein phosphatase 2C 17 OS=Oryza sativa subsp. japonica GN=Os02g0599150 PE=2 SV=1 6 297 1.0E-42
sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 OS=Oryza sativa subsp. japonica GN=Os06g0597200 PE=2 SV=1 31 289 2.0E-42
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 30 289 4.0E-42
sp|Q0DZT4|P2C19_ORYSJ Probable protein phosphatase 2C 19 OS=Oryza sativa subsp. japonica GN=Os02g0599700 PE=3 SV=2 6 292 9.0E-42
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 31 291 4.0E-41
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 31 289 9.0E-41
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 18 294 1.0E-39
sp|Q9LUU7|P2C43_ARATH Probable protein phosphatase 2C 43 OS=Arabidopsis thaliana GN=At3g17250 PE=2 SV=1 27 289 1.0E-38
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 31 289 1.0E-38
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 31 290 2.0E-38
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 30 291 1.0E-37
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 25 289 2.0E-37
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 30 289 2.0E-37
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 24 246 2.0E-37
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 24 246 3.0E-37
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 31 289 4.0E-37
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 17 289 1.0E-36
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 18 293 2.0E-36
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 26 289 8.0E-36
sp|A3A8W6|P2C22_ORYSJ Putative protein phosphatase 2C 22 OS=Oryza sativa subsp. japonica GN=Os02g0607500 PE=3 SV=2 8 257 9.0E-36
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 19 291 2.0E-35
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 26 289 5.0E-35
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 18 287 6.0E-35
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 18 291 7.0E-35
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 24 253 1.0E-34
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 32 289 1.0E-34
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 25 246 1.0E-34
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 26 289 2.0E-34
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 19 251 2.0E-34
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 18 291 2.0E-34
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 25 297 2.0E-34
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 31 290 2.0E-34
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 26 289 2.0E-34
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 25 251 4.0E-34
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 18 246 6.0E-34
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 24 294 7.0E-34
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 33 291 3.0E-33
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 27 289 3.0E-33
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 16 294 1.0E-32
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 23 249 2.0E-32
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 23 252 2.0E-32
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 24 256 1.0E-31
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 27 256 3.0E-31
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 23 249 3.0E-31
sp|P36982|PP2C_LEICH Protein phosphatase 2C OS=Leishmania chagasi PE=2 SV=1 1 343 5.0E-31
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 21 293 1.0E-30
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 36 246 1.0E-30
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 24 246 1.0E-30
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 29 259 2.0E-30
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 24 289 2.0E-30
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 13 289 6.0E-30
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 26 289 1.0E-29
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 29 295 1.0E-29
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 24 246 3.0E-29
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 56 249 3.0E-29
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 46 246 2.0E-28
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 53 249 2.0E-28
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 24 246 3.0E-28
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 13 289 5.0E-28
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 35 246 8.0E-28
sp|Q6L4R7|P2C53_ORYSJ Probable protein phosphatase 2C 53 OS=Oryza sativa subsp. japonica GN=Os05g0592800 PE=2 SV=1 56 249 1.0E-27
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 56 291 1.0E-27
sp|Q9CAJ0|P2C16_ARATH Protein phosphatase 2C 16 OS=Arabidopsis thaliana GN=HAB1 PE=1 SV=1 23 249 2.0E-27
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 21 246 2.0E-27
sp|P49599|P2C57_ARATH Protein phosphatase 2C 57 OS=Arabidopsis thaliana GN=PPH1 PE=1 SV=2 24 329 2.0E-27
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 13 289 2.0E-27
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 31 299 3.0E-27
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 56 250 3.0E-27
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 36 246 4.0E-27
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 52 245 5.0E-27
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 31 247 6.0E-27
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 56 245 3.0E-26
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 23 289 3.0E-26
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 23 289 4.0E-26
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 23 289 4.0E-26
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 23 249 6.0E-26
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 51 246 7.0E-26
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 36 246 2.0E-25
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 24 292 2.0E-25
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 24 240 8.0E-25
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 50 246 9.0E-25
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 56 245 1.0E-24
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 56 246 2.0E-24
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 24 260 3.0E-24
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 36 246 4.0E-24
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 31 299 4.0E-24
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 56 246 2.0E-23
sp|Q5R522|PPM1K_PONAB Protein phosphatase 1K, mitochondrial OS=Pongo abelii GN=PPM1K PE=2 SV=1 51 233 1.0E-22
sp|Q9XGZ9|P2C72_ARATH Probable protein phosphatase 2C 72 OS=Arabidopsis thaliana GN=At5g26010 PE=2 SV=2 20 245 3.0E-22
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 56 258 5.0E-22
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 12 246 3.0E-21
sp|Q5JKN1|P2C05_ORYSJ Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1 24 294 5.0E-21
sp|Q7XJ53|P2C35_ARATH Probable protein phosphatase 2C 35 OS=Arabidopsis thaliana GN=At3g06270 PE=2 SV=1 19 252 8.0E-21
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 56 287 8.0E-21
sp|O82637|P2C61_ARATH Probable protein phosphatase 2C 61 OS=Arabidopsis thaliana GN=At4g32950 PE=3 SV=1 23 260 1.0E-20
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 24 315 2.0E-19
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 56 245 4.0E-19
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1 138 6.0E-19
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 19 245 1.0E-18
sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2 42 253 1.0E-18
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 24 321 6.0E-18
sp|Q9SUF4|P2C53_ARATH Putative protein phosphatase 2C 53 OS=Arabidopsis thaliana GN=At4g08260 PE=5 SV=1 36 291 6.0E-18
sp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana GN=At5g66080 PE=2 SV=1 56 246 2.0E-17
sp|Q6NKS1|P2C65_ARATH Probable protein phosphatase 2C 65 OS=Arabidopsis thaliana GN=At5g01700 PE=2 SV=1 50 245 7.0E-17
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2 94 245 1.0E-16
sp|Q54WS9|Y9461_DICDI Probable protein phosphatase DDB_G0279461 OS=Dictyostelium discoideum GN=DDB_G0279461 PE=3 SV=2 36 289 3.0E-16
sp|Q3EAZ3|P2C45_ARATH Putative protein phosphatase 2C-like protein 45 OS=Arabidopsis thaliana GN=At3g27140 PE=5 SV=1 36 246 4.0E-16
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1 30 258 5.0E-16
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 56 246 6.0E-16
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 56 245 1.0E-15
sp|P49594|FEM2_CAEEL Ca(2+)/calmodulin-dependent protein kinase phosphatase OS=Caenorhabditis elegans GN=fem-2 PE=1 SV=2 49 286 1.0E-15
sp|Q9M9C6|P2C15_ARATH Probable protein phosphatase 2C 15 OS=Arabidopsis thaliana GN=At1g68410 PE=2 SV=1 51 246 1.0E-15
sp|Q7XP01|P2C37_ORYSJ Probable protein phosphatase 2C 37 OS=Oryza sativa subsp. japonica GN=Os04g0167900 PE=3 SV=2 118 246 1.0E-15
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 91 245 1.0E-15
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 56 287 2.0E-15
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 52 245 3.0E-15
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 44 245 3.0E-15
sp|Q96MI6|PPM1M_HUMAN Protein phosphatase 1M OS=Homo sapiens GN=PPM1M PE=2 SV=1 94 246 3.0E-15
sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana GN=At2g20050/At2g20040 PE=2 SV=2 51 245 4.0E-15
sp|Q9LR65|P2C01_ARATH Probable protein phosphatase 2C 1 OS=Arabidopsis thaliana GN=PPC6-6 PE=1 SV=1 91 245 5.0E-15
sp|Q54T01|Y2105_DICDI Probable protein phosphatase DDB_G0282105 OS=Dictyostelium discoideum GN=DDB_G0282105 PE=3 SV=1 31 289 5.0E-15
sp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana GN=At3g51370 PE=2 SV=1 56 246 5.0E-15
sp|Q9SA22|P2C06_ARATH Probable protein phosphatase 2C 6 OS=Arabidopsis thaliana GN=At1g16220 PE=2 SV=1 93 252 6.0E-15
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 49 300 6.0E-15
sp|Q9FX08|P2C12_ARATH Probable protein phosphatase 2C 12 OS=Arabidopsis thaliana GN=At1g47380 PE=2 SV=1 48 246 7.0E-15
sp|Q8RXZ4|P2C18_ARATH Probable protein phosphatase 2C 18 OS=Arabidopsis thaliana GN=At1g79630 PE=2 SV=1 94 245 7.0E-15
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 53 245 8.0E-15
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 56 287 2.0E-14
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 17 248 3.0E-14
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1 106 4.0E-14
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1 106 4.0E-14
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1 106 4.0E-14
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 129 246 4.0E-14
sp|Q67J17|P2C69_ORYSJ Probable protein phosphatase 2C 69 OS=Oryza sativa subsp. japonica GN=Os09g0459600 PE=2 SV=1 50 246 5.0E-14
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1 106 6.0E-14
sp|Q8BU27|PPM1M_MOUSE Protein phosphatase 1M OS=Mus musculus GN=Ppm1m PE=2 SV=2 56 289 6.0E-14
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1 106 7.0E-14
sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana GN=At4g03415 PE=2 SV=1 51 245 9.0E-14
sp|Q7XTC7|P2C40_ORYSJ Probable protein phosphatase 2C 40 OS=Oryza sativa subsp. japonica GN=Os04g0449400 PE=3 SV=3 57 246 1.0E-13
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1 53 245 1.0E-13
sp|Q9M8R7|P2C33_ARATH Probable protein phosphatase 2C 33 OS=Arabidopsis thaliana GN=PPC6-1 PE=1 SV=1 97 245 2.0E-13
sp|O80492|P2C05_ARATH Probable protein phosphatase 2C 5 OS=Arabidopsis thaliana GN=At1g09160 PE=2 SV=1 50 238 2.0E-13
sp|Q6YTI2|P2C15_ORYSJ Probable protein phosphatase 2C 15 OS=Oryza sativa subsp. japonica GN=Os02g0567200 PE=2 SV=1 46 246 2.0E-13
sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryza sativa subsp. japonica GN=Os08g0500300 PE=2 SV=1 97 245 6.0E-13
sp|O15297|PPM1D_HUMAN Protein phosphatase 1D OS=Homo sapiens GN=PPM1D PE=1 SV=1 49 289 7.0E-13
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 56 246 9.0E-13
sp|Q6K6N7|P2C14_ORYSJ Probable protein phosphatase 2C 14 OS=Oryza sativa subsp. japonica GN=Os02g0471500 PE=2 SV=1 97 251 1.0E-12
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1 51 247 1.0E-12
sp|Q0JMD4|P2C03_ORYSJ Probable protein phosphatase 2C 3 OS=Oryza sativa subsp. japonica GN=Os01g0513100 PE=2 SV=2 55 246 2.0E-12
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 94 245 2.0E-12
sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 81 299 2.0E-12
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 94 245 2.0E-12
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza sativa subsp. japonica GN=Os04g0584300 PE=3 SV=2 53 245 2.0E-12
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 94 245 2.0E-12
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 1 108 3.0E-12
sp|O81760|P2C63_ARATH Probable protein phosphatase 2C 63 OS=Arabidopsis thaliana GN=At4g33920 PE=2 SV=1 51 245 3.0E-12
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 94 245 3.0E-12
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 117 251 4.0E-12
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 94 245 4.0E-12
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 94 245 5.0E-12
sp|Q9QZ67|PPM1D_MOUSE Protein phosphatase 1D OS=Mus musculus GN=Ppm1d PE=2 SV=2 49 289 5.0E-12
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 117 245 6.0E-12
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 50 245 7.0E-12
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 119 283 9.0E-12
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 56 245 2.0E-11
sp|Q10MN6|P2C33_ORYSJ Probable protein phosphatase 2C 33 OS=Oryza sativa subsp. japonica GN=Os03g0301700 PE=2 SV=1 50 246 2.0E-11
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1 34 245 8.0E-11
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. indica GN=BIPP2C2 PE=2 SV=2 34 245 8.0E-11
sp|Q93YS2|P2C51_ARATH Probable protein phosphatase 2C 51 OS=Arabidopsis thaliana GN=At3g63340 PE=2 SV=2 94 306 8.0E-11
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 52 245 1.0E-10
sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1 56 245 1.0E-10
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 57 245 2.0E-10
sp|Q9M1V8|P2C50_ARATH Putative protein phosphatase 2C 50 OS=Arabidopsis thaliana GN=At3g63320 PE=3 SV=1 58 289 3.0E-10
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 56 245 5.0E-10
sp|P46014|P2C70_ARATH Protein phosphatase 2C 70 OS=Arabidopsis thaliana GN=KAPP PE=1 SV=2 31 245 1.0E-09
sp|Q28DF4|PPM1H_XENTR Protein phosphatase 1H OS=Xenopus tropicalis GN=ppm1h PE=2 SV=1 94 245 2.0E-09
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 41 246 3.0E-09
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 41 246 3.0E-09
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 118 246 7.0E-09
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 41 246 1.0E-08
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 53 245 2.0E-08
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 37 245 3.0E-08
sp|A8MPX8|PP2D1_HUMAN Protein phosphatase 2C-like domain-containing protein 1 OS=Homo sapiens GN=PP2D1 PE=2 SV=2 131 241 1.0E-06
sp|Q0D629|P2C63_ORYSJ Putative protein phosphatase 2C 63 OS=Oryza sativa subsp. japonica GN=Os07g0516100 PE=5 SV=1 120 218 2.0E-06
sp|Q5JR12|PPM1J_HUMAN Protein phosphatase 1J OS=Homo sapiens GN=PPM1J PE=1 SV=1 56 167 2.0E-06
sp|Q8BVT6|PP2D1_MOUSE Protein phosphatase 2C-like domain-containing protein 1 OS=Mus musculus GN=Pp2d1 PE=2 SV=1 131 245 2.0E-06
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 47 232 3.0E-06
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 118 267 7.0E-06
sp|Q149T7|PPM1J_MOUSE Protein phosphatase 1J OS=Mus musculus GN=Ppm1j PE=1 SV=1 56 167 8.0E-06
sp|Q9ULR3|PPM1H_HUMAN Protein phosphatase 1H OS=Homo sapiens GN=PPM1H PE=1 SV=2 94 167 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103230
MGQTLSFPVIDKLSESGENVRFLYAVADMQGWRITMEDAHAAVLDLDGKGNDSTAFFAVYDGHGGSTVAKYAGQN
VHKRLILEEPYKEKNYELAMKKAFLGIDEDLQANPAHSKDPSGCTAVAALVTEDKIYVANAGDSRSVLSAKGEVK
PLSFDHKPTNDVERTRICDAGGYIEYGRVNGNLALSRALGDFEFKKNLSLGPEAQMITANPDVTIHEITEEDEFL
VLACDGIWDCLSSQQVVDFVRYQVSQDKELTEIGKMLCDHCLAPDTASGAGIGCDNMTVLIVALLQGRTKEQWYT
WIKDRVEKEYGHATPSTLPQLYSVGRLMSFKMRMEAVASRNNTRNSQEEESNPLGFLAGTGLGSGITSDNGTLMF
NQDDSDEEDEEEEPVNSSSFFNRTYSLGGRSESPDPTTQLKARLDEFERGLDEEGDTKMADATEDGKELQGEAPP
PPKPLPNGDAHPPITPVQQLQSQPGGDTANPVVKAEGFLDASEDPLKGS*
Coding >AgabiH97|103230
ATGGGTCAAACGCTTTCGTTTCCAGTGATTGATAAACTCTCGGAGTCGGGGGAGAATGTACGGTTCCTCTATGCA
GTTGCTGATATGCAAGGATGGCGAATCACGATGGAGGATGCCCATGCTGCGGTGCTGGACCTCGACGGGAAAGGC
AATGACTCAACAGCATTCTTTGCGGTGTATGATGGGCACGGCGGTAGTACCGTTGCCAAATACGCAGGGCAGAAT
GTGCATAAACGTCTAATCCTTGAAGAACCTTACAAAGAAAAGAATTACGAGCTTGCCATGAAGAAAGCATTCCTC
GGCATTGATGAAGATCTCCAAGCCAATCCCGCACATTCAAAAGATCCCTCTGGTTGTACAGCAGTCGCTGCTTTG
GTCACCGAGGACAAAATCTACGTCGCTAATGCTGGCGATTCACGGTCTGTCCTCAGCGCTAAAGGTGAAGTGAAG
CCTTTAAGTTTTGACCATAAGCCTACAAATGATGTTGAACGCACTCGAATTTGTGACGCCGGAGGTTACATCGAG
TATGGCCGTGTTAACGGCAATCTTGCTCTCTCCCGCGCCCTTGGCGACTTTGAATTCAAGAAAAATTTGTCTTTA
GGGCCTGAGGCCCAAATGATCACGGCGAACCCGGATGTAACGATACACGAAATTACGGAGGAAGACGAGTTTTTA
GTCTTGGCATGTGATGGGATTTGGGATTGTCTATCGTCCCAACAAGTCGTCGACTTTGTGAGGTATCAGGTCTCT
CAGGATAAAGAGCTCACGGAAATCGGGAAAATGCTTTGTGATCATTGTCTTGCCCCTGATACAGCATCAGGGGCG
GGTATTGGCTGTGACAACATGACTGTTCTCATTGTTGCTTTACTCCAGGGCCGCACAAAGGAGCAGTGGTATACA
TGGATCAAGGATCGCGTAGAGAAAGAATACGGACATGCCACTCCTAGCACTCTTCCTCAACTTTATTCAGTAGGC
CGGTTGATGTCTTTCAAAATGAGGATGGAAGCGGTAGCAAGTCGAAACAATACCCGTAACTCTCAAGAAGAAGAG
AGCAACCCTCTCGGTTTTTTGGCAGGTACTGGACTCGGCTCTGGGATCACGAGTGATAATGGGACGTTGATGTTT
AATCAGGATGACAGTGACGAGGAAGATGAAGAGGAAGAGCCCGTCAATTCCTCATCATTTTTCAACCGGACATAC
TCTCTTGGTGGTCGTTCCGAATCTCCTGATCCGACAACACAGCTCAAAGCGCGCTTGGATGAGTTCGAGCGGGGT
TTAGATGAAGAAGGTGATACGAAAATGGCAGATGCTACGGAAGATGGAAAAGAGCTGCAAGGAGAGGCACCGCCG
CCACCGAAACCTCTACCAAATGGCGATGCACATCCTCCCATAACTCCTGTACAACAGCTTCAGTCACAGCCTGGA
GGAGATACAGCAAATCCTGTGGTCAAAGCGGAGGGTTTCCTTGATGCCAGCGAGGACCCACTGAAAGGATCCTGA
Transcript >AgabiH97|103230
ATGGGTCAAACGCTTTCGTTTCCAGTGATTGATAAACTCTCGGAGTCGGGGGAGAATGTACGGTTCCTCTATGCA
GTTGCTGATATGCAAGGATGGCGAATCACGATGGAGGATGCCCATGCTGCGGTGCTGGACCTCGACGGGAAAGGC
AATGACTCAACAGCATTCTTTGCGGTGTATGATGGGCACGGCGGTAGTACCGTTGCCAAATACGCAGGGCAGAAT
GTGCATAAACGTCTAATCCTTGAAGAACCTTACAAAGAAAAGAATTACGAGCTTGCCATGAAGAAAGCATTCCTC
GGCATTGATGAAGATCTCCAAGCCAATCCCGCACATTCAAAAGATCCCTCTGGTTGTACAGCAGTCGCTGCTTTG
GTCACCGAGGACAAAATCTACGTCGCTAATGCTGGCGATTCACGGTCTGTCCTCAGCGCTAAAGGTGAAGTGAAG
CCTTTAAGTTTTGACCATAAGCCTACAAATGATGTTGAACGCACTCGAATTTGTGACGCCGGAGGTTACATCGAG
TATGGCCGTGTTAACGGCAATCTTGCTCTCTCCCGCGCCCTTGGCGACTTTGAATTCAAGAAAAATTTGTCTTTA
GGGCCTGAGGCCCAAATGATCACGGCGAACCCGGATGTAACGATACACGAAATTACGGAGGAAGACGAGTTTTTA
GTCTTGGCATGTGATGGGATTTGGGATTGTCTATCGTCCCAACAAGTCGTCGACTTTGTGAGGTATCAGGTCTCT
CAGGATAAAGAGCTCACGGAAATCGGGAAAATGCTTTGTGATCATTGTCTTGCCCCTGATACAGCATCAGGGGCG
GGTATTGGCTGTGACAACATGACTGTTCTCATTGTTGCTTTACTCCAGGGCCGCACAAAGGAGCAGTGGTATACA
TGGATCAAGGATCGCGTAGAGAAAGAATACGGACATGCCACTCCTAGCACTCTTCCTCAACTTTATTCAGTAGGC
CGGTTGATGTCTTTCAAAATGAGGATGGAAGCGGTAGCAAGTCGAAACAATACCCGTAACTCTCAAGAAGAAGAG
AGCAACCCTCTCGGTTTTTTGGCAGGTACTGGACTCGGCTCTGGGATCACGAGTGATAATGGGACGTTGATGTTT
AATCAGGATGACAGTGACGAGGAAGATGAAGAGGAAGAGCCCGTCAATTCCTCATCATTTTTCAACCGGACATAC
TCTCTTGGTGGTCGTTCCGAATCTCCTGATCCGACAACACAGCTCAAAGCGCGCTTGGATGAGTTCGAGCGGGGT
TTAGATGAAGAAGGTGATACGAAAATGGCAGATGCTACGGAAGATGGAAAAGAGCTGCAAGGAGAGGCACCGCCG
CCACCGAAACCTCTACCAAATGGCGATGCACATCCTCCCATAACTCCTGTACAACAGCTTCAGTCACAGCCTGGA
GGAGATACAGCAAATCCTGTGGTCAAAGCGGAGGGTTTCCTTGATGCCAGCGAGGACCCACTGAAAGGATCCTGA
Gene >AgabiH97|103230
ATGGTCTGTATTTTACTGGCTTTCCAACCTCACGACCATTCACCTCTCCACTTCAAAAGGGTCAAACGCTTTCGT
TTCCAGGTAAACAAAAACATAAAAATTGATGTTATCAATCCCGTGTTTTATCTGTTATCTCATACTTTGCTTTCT
CAGTGATTGATAAACTCTCGGAGTCGGGGGAGAATGTACGGTTCCTCTATGCAGTTGCTGATATGCAAGGATGGC
GAATCAGTAAGTTCCTTCGTCCCCACCATCACATCCCCGACTTCTTCGGGCTTGTTCAGAGGCGGCACTCACGCA
ACGTCTTAGCGATGGAGGATGCCCATGCTGCGGTGCTGGACCTCGACGGGAAAGGCAATGACTCAACAGCATTCT
TTGCGGTGTATGATGGGCACGGCGGTGAGAACATATCCTCGACATTTGTGAAATCCCCCGACCACTTACTTCTTT
CCAGGTAGTACCGTTGCCAAATACGCAGGGCAGAATGTGCATAAACGTCTAATCCTTGAAGAACCTTACAAAGAA
AAGAATTACGAGCTTGCCATGAAGAAAGCATTCCTCGGCATTGATGAAGATCTCCAAGCCAGTATGCGTTCCCCT
TTCTCCGGCAGAGTATCCTTCACCTGATGATCTTTATAAGATCCCGCACATTCAAAAGATCCCTCTGGTTGTACA
GCAGTCGCTGCTTTGGTCACCGAGGACAAAATCTACGTCGTACGGTTCCTGTCTTCTTAACGGCATCCACGCCGA
TCTGACGGCATCTCTATAGGCTAATGCTGGCGATTCACGGTCTGTCCTCAGCGCTAAAGGTGAAGTGAAGCCTTT
AAGTTTTGACCATAAGCCTACAAATGATGGTTCGCTATTTCCGTACTTTGACCTAAATTTTATCTCAGAGATACC
ATTTAGTTGAACGCACTCGAATTTGTGACGCCGGAGGTTACATCGAGTATGGCCGTGTTAACGGTCGGTAACTTG
CCTCGCATTAGCTCCTCCTCTGACATTGCGACAGGCAATCTTGCTCTCTCCCGCGCCCTTGGCGACTTTGAATTC
AAGAAAAATTTGTCTTTAGGGCCTGAGGCCCAAATGATCACGGCGAACCCGGATGTAACGATACACGAAATTACG
GAGGAAGACGAGTTTTTAGTCTTGGCATGTGATGGTACGACAACTACCCGAGCTGATTGCTGCCGCTTTTACTTA
CTTTTGGCTTAGGGATTTGGGATTGTCTATCGTCCCAACAAGTCGTCGACTTTGTGAGGTATCAGGTCTCTCAGG
ATAAAGAGCTCACGGAAATCGGGAAAATGCTTTGTGATCATTGTCTTGCCCCTGATACAGCATCAGGGGCGGGTA
TTGGCTGTGACAACATGACTGTTCTCATTGTTGCTTTACTCCAGGGCCGCACAAAGGAGCAGTGGTATACATGGA
TCAAGGATCGCGTAGAGAAAGAATACGGACATGCCACTCCTAGCACTCTTCCTCAACTTTATTCAGTAGGCCGGT
TGATGTCTTTCAAAATGAGGATGGAAGCGGTAGCAAGTCGAAACAATACCCGTAACTCTCAAGAAGAAGAGAGCA
ACCCTCTCGGTTTTTTGGCAGGTACTGGACTCGGTGGGTTCGCTCGGGTCCTCGGCAGTACGGGTGGAATCTCAT
TTCGCCCAGGCTCTGGGATCACGAGTGATAATGGGACGTTGATGTTTAATCAGGATGACAGTGACGAGGAAGATG
AAGAGGAAGAGCCCGTCAATTCCTCATCATTTTTCAACCGGACATACTCTCTTGGTGGTCGTTCCGAATCTCCTG
ATCCGACAACACAGCTCAAAGCGCGCTTGGATGAGTTCGAGCGGGGTTTAGATGAAGAAGGTGATACGAAAATGG
CAGATGCTACGGAAGATGGAAAAGAGCTGCAAGGAGAGGCACCGCCGCCACCGAAACCTCTACCAAATGGCGATG
CACATCCTCCCATAACTCCTGTACAACAGCTTCAGTCACAGCCTGGAGGAGATACAGCAAATCCTGTGGTCAAAG
CGGAGGGTTTCCTTGATGCCAGCGAGGACCCACTGAAAGGATCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail