Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|103050
Gene name
Locationscaffold_7:1494462..1496544
Strand+
Gene length (bp)2082
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 4.7E-34 46 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 37 401 5.0E-13
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 36 407 3.0E-11
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 37 404 5.0E-10
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 4 385 6.0E-10
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 4 385 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 37 401 5.0E-13
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 36 407 3.0E-11
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 37 404 5.0E-10
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 4 385 6.0E-10
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 4 385 6.0E-10
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 22 385 7.0E-10
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 4 385 7.0E-10
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 37 385 9.0E-10
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 23 385 1.0E-09
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 4 385 3.0E-09
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 4 385 3.0E-09
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 22 385 3.0E-09
sp|P94958|AMPC_MORMO Beta-lactamase OS=Morganella morganii GN=ampC PE=3 SV=1 4 385 4.0E-09
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 7 404 6.0E-09
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 7 404 7.0E-09
sp|P86789|GIGA6_CRAGI Gigasin-6 OS=Crassostrea gigas PE=1 SV=1 5 300 6.0E-08
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 39 404 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|103050
MAVFKSLLKTCLVTFVLPRYCLSLNSPHQGKLITPDVDEFIQSVIQQWNLTGLAIAVVRQDPNSPTGWLQEFGSY
GNAKADGTPVTPDTLFSLASNSKLFTALSTGLLISNETLKEEMGIDLSWSSKAQDVFGETWGLMDEDASQGTSLQ
DMLSHQTGLPRHDASNIPRSGGLIDKVRTLRYLRPSAEFREIYQYNNLLYDSLGLLPEVLVGQSLSAFVDHQIFK
PLGMTNSTYSIAEAEKRLLADGFQISGQDLKRGLNGTKKPIIPFYERPGEESIGAGSGGVISSARDMVKWVSMLL
VLGKHPHQGQQIVPTEVVNHAATGRSVVAGKASFPEMSPILYGAGQLTYSYRGHQVVDHGGNVLGFSSSVARLPN
DNLGIVILNNDWDANSAITAIKWRLVDEIVIRATSPSSPLIDWISRYKEIDRRQKQASKIFTPRPPHPPLPSLPF
SELVRKTYSHPSYGQLRLCQATSPAPSSPWENLWGETFSIADQDCSVVVNSPAVKRILETTDLSVPTFISQFKSI
FTTHIRLSHFSGNVFNATAIWTNSQVRMDEGYGSWDGGTWKDDEDVMISLMEFSVEWATEREEGLAFKGGIWGMG
EGAREPLGSGKEAAEVWFHGMG*
Coding >AgabiH97|103050
ATGGCGGTCTTCAAGTCCCTTCTGAAAACCTGCTTAGTAACCTTCGTCCTTCCTCGATACTGTCTTTCTTTGAAT
AGTCCTCACCAAGGAAAGCTTATTACTCCAGATGTCGACGAGTTCATCCAGTCCGTGATCCAACAATGGAATCTC
ACCGGTCTCGCTATCGCCGTGGTTCGTCAAGACCCGAATTCACCCACTGGCTGGCTCCAAGAATTCGGGTCTTAT
GGGAATGCGAAAGCAGATGGAACTCCGGTCACGCCAGACACTTTGTTCTCGTTGGCTTCGAATAGCAAGCTGTTC
ACGGCACTGTCTACCGGTCTATTAATTTCAAATGAAACGCTGAAGGAGGAAATGGGCATCGATTTGTCTTGGTCT
TCTAAAGCCCAGGATGTTTTCGGAGAAACATGGGGTCTTATGGATGAAGATGCGAGCCAAGGGACAAGCCTCCAG
GATATGTTGTCGCATCAGACAGGATTACCCCGACATGACGCAAGTAATATCCCGAGGTCTGGAGGGCTCATCGAT
AAAGTTAGAACATTACGATATCTTCGTCCATCTGCTGAGTTTCGGGAAATCTATCAATACAACAACCTCTTATAT
GATTCTCTCGGGCTTCTACCTGAAGTCTTGGTTGGCCAATCGCTGAGTGCTTTTGTCGACCATCAGATCTTCAAA
CCATTGGGAATGACAAATTCCACATATTCTATTGCCGAGGCTGAGAAGCGTCTTCTGGCGGATGGTTTCCAAATC
AGTGGGCAGGACTTGAAGCGAGGTTTGAATGGTACCAAGAAACCAATCATTCCATTTTATGAAAGACCTGGGGAA
GAATCGATTGGCGCAGGTTCTGGAGGTGTAATTAGCTCTGCTAGAGACATGGTCAAGTGGGTTTCTATGCTCTTG
GTTCTTGGAAAACATCCACACCAGGGTCAACAAATTGTGCCCACGGAAGTTGTAAATCATGCAGCAACTGGAAGA
TCTGTAGTCGCTGGAAAGGCCAGCTTTCCCGAGATGAGCCCTATCTTGTATGGTGCAGGTCAATTAACATACTCT
TATAGAGGTCACCAGGTAGTCGACCACGGGGGCAACGTCCTCGGGTTTTCGTCCTCGGTTGCTCGATTGCCAAAT
GACAACCTGGGCATCGTCATCCTCAATAATGACTGGGATGCAAATTCCGCAATCACTGCTATCAAATGGCGGCTC
GTAGATGAAATTGTCATCAGAGCCACTTCTCCCAGCAGTCCGTTAATAGATTGGATTTCGAGGTACAAAGAAATT
GATCGACGACAAAAGCAAGCAAGCAAAATTTTTACTCCTCGACCACCTCATCCTCCTCTTCCGAGCTTGCCGTTT
TCTGAGCTTGTGCGCAAGACCTATAGCCATCCATCATACGGACAACTGAGACTCTGTCAAGCCACATCTCCAGCT
CCCTCTTCTCCCTGGGAAAACTTATGGGGCGAAACTTTCAGTATCGCAGACCAAGACTGTTCAGTAGTAGTCAAT
TCACCAGCGGTGAAACGAATTCTCGAAACGACAGATCTATCAGTTCCGACTTTCATCTCCCAGTTCAAAAGCATC
TTTACAACGCACATCCGCCTCAGCCATTTTTCAGGCAACGTTTTCAATGCTACTGCAATATGGACTAATAGTCAA
GTACGTATGGATGAGGGCTATGGGTCATGGGATGGGGGCACTTGGAAAGATGACGAGGATGTCATGATATCCCTT
ATGGAATTTTCAGTTGAATGGGCTACTGAAAGGGAAGAAGGACTTGCCTTTAAAGGGGGCATTTGGGGAATGGGG
GAGGGTGCGAGAGAACCACTAGGCAGTGGGAAAGAGGCAGCGGAGGTCTGGTTTCATGGAATGGGTTGA
Transcript >AgabiH97|103050
ATGGCGGTCTTCAAGTCCCTTCTGAAAACCTGCTTAGTAACCTTCGTCCTTCCTCGATACTGTCTTTCTTTGAAT
AGTCCTCACCAAGGAAAGCTTATTACTCCAGATGTCGACGAGTTCATCCAGTCCGTGATCCAACAATGGAATCTC
ACCGGTCTCGCTATCGCCGTGGTTCGTCAAGACCCGAATTCACCCACTGGCTGGCTCCAAGAATTCGGGTCTTAT
GGGAATGCGAAAGCAGATGGAACTCCGGTCACGCCAGACACTTTGTTCTCGTTGGCTTCGAATAGCAAGCTGTTC
ACGGCACTGTCTACCGGTCTATTAATTTCAAATGAAACGCTGAAGGAGGAAATGGGCATCGATTTGTCTTGGTCT
TCTAAAGCCCAGGATGTTTTCGGAGAAACATGGGGTCTTATGGATGAAGATGCGAGCCAAGGGACAAGCCTCCAG
GATATGTTGTCGCATCAGACAGGATTACCCCGACATGACGCAAGTAATATCCCGAGGTCTGGAGGGCTCATCGAT
AAAGTTAGAACATTACGATATCTTCGTCCATCTGCTGAGTTTCGGGAAATCTATCAATACAACAACCTCTTATAT
GATTCTCTCGGGCTTCTACCTGAAGTCTTGGTTGGCCAATCGCTGAGTGCTTTTGTCGACCATCAGATCTTCAAA
CCATTGGGAATGACAAATTCCACATATTCTATTGCCGAGGCTGAGAAGCGTCTTCTGGCGGATGGTTTCCAAATC
AGTGGGCAGGACTTGAAGCGAGGTTTGAATGGTACCAAGAAACCAATCATTCCATTTTATGAAAGACCTGGGGAA
GAATCGATTGGCGCAGGTTCTGGAGGTGTAATTAGCTCTGCTAGAGACATGGTCAAGTGGGTTTCTATGCTCTTG
GTTCTTGGAAAACATCCACACCAGGGTCAACAAATTGTGCCCACGGAAGTTGTAAATCATGCAGCAACTGGAAGA
TCTGTAGTCGCTGGAAAGGCCAGCTTTCCCGAGATGAGCCCTATCTTGTATGGTGCAGGTCAATTAACATACTCT
TATAGAGGTCACCAGGTAGTCGACCACGGGGGCAACGTCCTCGGGTTTTCGTCCTCGGTTGCTCGATTGCCAAAT
GACAACCTGGGCATCGTCATCCTCAATAATGACTGGGATGCAAATTCCGCAATCACTGCTATCAAATGGCGGCTC
GTAGATGAAATTGTCATCAGAGCCACTTCTCCCAGCAGTCCGTTAATAGATTGGATTTCGAGGTACAAAGAAATT
GATCGACGACAAAAGCAAGCAAGCAAAATTTTTACTCCTCGACCACCTCATCCTCCTCTTCCGAGCTTGCCGTTT
TCTGAGCTTGTGCGCAAGACCTATAGCCATCCATCATACGGACAACTGAGACTCTGTCAAGCCACATCTCCAGCT
CCCTCTTCTCCCTGGGAAAACTTATGGGGCGAAACTTTCAGTATCGCAGACCAAGACTGTTCAGTAGTAGTCAAT
TCACCAGCGGTGAAACGAATTCTCGAAACGACAGATCTATCAGTTCCGACTTTCATCTCCCAGTTCAAAAGCATC
TTTACAACGCACATCCGCCTCAGCCATTTTTCAGGCAACGTTTTCAATGCTACTGCAATATGGACTAATAGTCAA
GTACGTATGGATGAGGGCTATGGGTCATGGGATGGGGGCACTTGGAAAGATGACGAGGATGTCATGATATCCCTT
ATGGAATTTTCAGTTGAATGGGCTACTGAAAGGGAAGAAGGACTTGCCTTTAAAGGGGGCATTTGGGGAATGGGG
GAGGGTGCGAGAGAACCACTAGGCAGTGGGAAAGAGGCAGCGGAGGTCTGGTTTCATGGAATGGGTTGA
Gene >AgabiH97|103050
ATGGCGGTCTTCAAGTCCCTTCTGAAAACCTGCTTAGTAACCTTCGTCCTTCCTCGATACTGTCTTTCTTTGAAT
AGTCCTCACCAAGGAAAGCTTATTACTCCAGATGTCGACGAGTTCATCCAGTCCGTGATCCAACAATGGAATCTC
ACCGGTCTCGCTATCGCCGTGGTTCGTCAAGACCCGAATTCACCCACTGGCTGGCTCCAAGAATTCGGGTCTTAT
GGGAATGCGAAAGCAGATGGAACTCCGGTCACGCCAGACACTTTGTTCTCGTTGGCTTCGAATAGCAAGCTGTTC
ACGGCACTGTCTACCGGTCTATTAATTTCAAATGAAACGCTGAAGGAGGAAATGGGCATCGATTTGTCTTGGTCT
TCTAAAGCCCAGGATGTTTTCGGAGAAACATGGGGTCTTATGGATGAAGATGCGAGCCAAGGGACAAGCCTCCAG
GATATGTTGTCGCATCAGACAGGATTACCCCGACATGACGCAAGTAATATCCCGAGGTCTGGAGGGCTCATCGAT
AAAGCATGTCGCATTACTTTCTTACTCTGCCTCATACTGACATTTGCTGAAGGTTAGAACATTACGATATCTTCG
TCCATCTGCTGAGTTTCGGGAAATCTATCAATACAACAACCTCTTATATGATTCTCTCGGGCTTCTACCTGAAGT
CTTGGTTGGCCAATCGCTGAGTGCTTTTGTCGACCATCAGATCTTCAAACCATTGGGAATGACAAATTCCACATA
TTCTATTGCCGAGGCTGAGAAGCGTCTTCTGGCGGATGGTTTCCAAATCAGTGGGCAGGACTTGAAGCGAGGTTT
GAATGGTACCAAGAAACCAATCATTCCATTTTATGAAAGACCTGGGGAAGAATCGATTGGCGCAGGTTCTGGAGG
TGTAATTAGCTCTGCTAGAGACATGGTAGGTTCATTGATGATATCGATAAGCAAATTTTACATTCGTCTTCAGGT
CAAGTGGGTTTCTATGCTCTTGGTTCTTGGAAAACATCCACACCAGGGTCAACAAATTGTGCCCACGGAAGTTGT
AAATCATGCAGCAACTGGAAGATCTGTAGTCGCTGGAAAGGCCAGCTTTCCCGAGATGGTGAAGTTCATCACATC
TTACGCGGCAGGGTATTTCTAATTTCTTTTTTGATTACCAGAGCCCTATCTTGTATGGTGCAGGTCAATTAACAT
ACTCTTATAGAGGTCACCAGGTAGTCGACCACGGGGGCAACGTCCTCGGGTTTTCGTCCTCGGTTGCTCGATTGC
CAAATGACAACCTGGGCATCGTCATCCTCAATAATGACTGGGATGCAAATTCCGCAATCACTGCTATCAAATGGC
GGCTCGTAGATGAAATTGTCATCAGAGCCACTTCTCCCAGCAGTCCGTTAATAGATTGGATTTCGAGGCAAGTAT
CACAGAATCTGAAGCATATGTTTCGTTTGTGTAACCTTTTGTAATTGCAGGTACAAAGAAATTGATCGACGACAA
AAGCAAGCAAGCAAAATTTTTACTCCTCGACCACCTCATCCTCCTCTTCCGAGCTTGCCGTTTTCTGAGCTTGTG
CGCAAGACCTATAGCCATCCATCATACGGACAACTGAGACTCTGTCAAGCCACATCTCCAGCTCCCTCTTCTCCC
TGGGAAAACTTATGGGGCGAAACTTTCAGTATCGCAGACCAAGACTGTTCAGTAGTAGTCAATTCACCAGCGGTG
AAACGAATTCTCGAAACGACAGATCTATCAGTTCCGACTTTCATCTCCCAGTTCAAAAGCATCTTTACAACGCAC
ATCCGCCTCAGCCATTTTTCAGGCAACGTTTTCAATGCTACTGCAATATGGACTAATAGTCAAGTACGTATGGAT
GAGGGCTATGGGTCATGGGATGGGGGCACTTGGAAAGATGACGAGGATGTCATGATATCCCTTATGGAATTTTCA
GTTGAATGGGCTACTGAAAGGGAAGAAGGACTTGCCTTTAAAGGGGGCATTTGGGGAATGGGGGAGGGTGCGAGA
GAACCACTAGGCAGTGGGAAAGAGGCAGCGGAGGTCTGGTTTCATGGAATGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail