Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102880
Gene name
Locationscaffold_7:1458027..1459142
Strand-
Gene length (bp)1115
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 5.1E-43 17 180
PF00071 Ras Ras family 6.9E-21 23 180
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 1.8E-15 23 133
PF09439 SRPRB Signal recognition particle receptor beta subunit 4.0E-11 19 146
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 9.3E-08 25 136
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.5E-07 22 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 1 181 2.0E-70
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 1 181 2.0E-70
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 1 181 2.0E-70
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 1 181 3.0E-70
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 1 181 5.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 1 181 2.0E-70
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 1 181 2.0E-70
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 1 181 2.0E-70
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 1 181 3.0E-70
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 1 181 5.0E-70
sp|Q2KI07|ARL8B_BOVIN ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1 1 181 1.0E-69
sp|Q6P8C8|ARL8A_XENTR ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1 1 181 2.0E-69
sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=1 SV=1 1 181 4.0E-69
sp|Q5R6E7|ARL8B_PONAB ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1 1 181 5.0E-69
sp|Q96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1 1 181 6.0E-69
sp|Q5ZKQ8|ARL8A_CHICK ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1 1 181 8.0E-69
sp|Q9VHV5|ARL8_DROME ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1 1 181 1.0E-68
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 4 181 5.0E-61
sp|A8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 20 180 1.0E-32
sp|Q54JJ3|ARFH_DICDI ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 1 178 2.0E-31
sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 3 180 3.0E-31
sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 4 181 9.0E-31
sp|P25160|ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 3 178 7.0E-30
sp|Q54V41|ARFK_DICDI ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 1 163 4.0E-29
sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 12 178 5.0E-29
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 12 178 1.0E-28
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 12 178 1.0E-28
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 12 178 1.0E-28
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 12 178 1.0E-28
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 12 155 1.0E-28
sp|Q54V47|ARFJ_DICDI ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 1 163 3.0E-28
sp|B5FYQ0|ARL3_TAEGU ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 19 179 9.0E-28
sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 6 178 9.0E-28
sp|Q8QHI3|ARL3_XENLA ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 19 179 1.0E-27
sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 6 178 1.0E-27
sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 6 178 2.0E-27
sp|Q1MTE5|ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 19 179 3.0E-27
sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 6 178 4.0E-27
sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 6 178 4.0E-27
sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 12 178 5.0E-27
sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 6 178 5.0E-27
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 6 178 7.0E-27
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 6 178 7.0E-27
sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 6 178 8.0E-27
sp|P22274|ARF_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 6 180 8.0E-27
sp|P40945|ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 6 178 1.0E-26
sp|Q75A26|ARF_ASHGO ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 6 178 1.0E-26
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 8 178 1.0E-26
sp|P11076|ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 3 178 1.0E-26
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 8 178 1.0E-26
sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 6 178 3.0E-26
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 6 178 4.0E-26
sp|P19146|ARF2_YEAST ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 3 178 4.0E-26
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 6 178 4.0E-26
sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 3 155 4.0E-26
sp|Q7KQL3|ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 3 155 4.0E-26
sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 1 180 5.0E-26
sp|P84079|ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 1 180 6.0E-26
sp|P84078|ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 1 180 6.0E-26
sp|Q4R5P2|ARF1_MACFA ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 1 180 6.0E-26
sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 1 180 6.0E-26
sp|P84080|ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 1 180 6.0E-26
sp|Q61LA8|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 1 180 7.0E-26
sp|Q9SHU5|ARF4_ARATH Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 9 178 9.0E-26
sp|P51824|ARF1_SOLTU ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 6 180 1.0E-25
sp|P34727|ARF_AJECA ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 6 178 1.0E-25
sp|P26991|ARF_GIAIN ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 15 179 1.0E-25
sp|Q10943|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 1 180 1.0E-25
sp|P61208|ARL4C_MOUSE ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 23 160 2.0E-25
sp|P56559|ARL4C_HUMAN ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 23 160 2.0E-25
sp|P91924|ARF_DUGJA ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 10 178 2.0E-25
sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 1 180 3.0E-25
sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 1 180 3.0E-25
sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 6 178 4.0E-25
sp|Q25761|ARF1_PLAFO ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 3 155 5.0E-25
sp|Q5BK71|ARL11_RAT ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1 20 170 8.0E-25
sp|Q7RVM2|ARF_NEUCR ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 3 178 1.0E-24
sp|P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 18 179 1.0E-24
sp|P61207|ARF3_TAKRU ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 8 180 1.0E-24
sp|P61206|ARF3_RAT ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 8 180 1.0E-24
sp|Q5R5P7|ARF3_PONAB ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 8 180 1.0E-24
sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 8 180 1.0E-24
sp|P61204|ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 8 180 1.0E-24
sp|Q5E9I6|ARF3_BOVIN ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 8 180 1.0E-24
sp|Q2YDM1|ARL1_BOVIN ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 18 179 2.0E-24
sp|P84083|ARF5_RAT ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 13 180 2.0E-24
sp|P84084|ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 13 180 2.0E-24
sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 13 180 2.0E-24
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 18 179 2.0E-24
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 18 179 2.0E-24
sp|Q969Q4|ARL11_HUMAN ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 20 177 4.0E-24
sp|P84082|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 1 180 5.0E-24
sp|Q8BSL7|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 1 180 5.0E-24
sp|P84081|ARF2_BOVIN ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 1 180 5.0E-24
sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 19 179 7.0E-24
sp|P51644|ARF4_XENLA ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 6 180 1.0E-23
sp|Q6P3A9|ARL11_MOUSE ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1 20 177 1.0E-23
sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 19 179 2.0E-23
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 6 178 2.0E-23
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 1 177 3.0E-23
sp|Q99PE9|ARL4D_MOUSE ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=2 23 133 4.0E-23
sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 18 179 6.0E-23
sp|O00909|ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 6 178 7.0E-23
sp|P49702|ARF5_CHICK ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 13 180 8.0E-23
sp|O45379|ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 19 178 8.0E-23
sp|O88848|ARL6_MOUSE ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 6 167 9.0E-23
sp|Q5M9P8|ARL6_DANRE ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 3 180 1.0E-22
sp|Q3SZF2|ARF4_BOVIN ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 6 180 1.0E-22
sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 19 179 1.0E-22
sp|Q9ZPX1|ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 23 179 1.0E-22
sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 18 179 2.0E-22
sp|Q0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 6 167 2.0E-22
sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 18 179 3.0E-22
sp|Q58DI9|ARL11_BOVIN ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1 20 177 4.0E-22
sp|P0CR30|SAR1_CRYNJ Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SAR1 PE=3 SV=1 16 179 9.0E-22
sp|P0CR31|SAR1_CRYNB Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SAR1 PE=3 SV=1 16 179 9.0E-22
sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 19 153 1.0E-21
sp|Q559R0|SAR1A_DICDI GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1 17 178 1.0E-21
sp|P61214|ARL4A_RAT ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 23 153 2.0E-21
sp|P61213|ARL4A_MOUSE ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 23 153 2.0E-21
sp|Q3T0M9|ARL4A_BOVIN ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 23 153 2.0E-21
sp|P61751|ARF4_RAT ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 6 180 2.0E-21
sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 6 180 2.0E-21
sp|P40617|ARL4A_HUMAN ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 23 153 2.0E-21
sp|P36405|ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 19 179 2.0E-21
sp|Q5RCF1|ARF4_PONAB ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 6 180 3.0E-21
sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 6 180 3.0E-21
sp|P37996|ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 19 179 3.0E-21
sp|Q52NJ4|ARL3_PIG ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 19 179 3.0E-21
sp|Q9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 19 179 4.0E-21
sp|Q2TBW6|ARL3_BOVIN ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 19 179 5.0E-21
sp|Q8N4G2|ARL14_HUMAN ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 18 155 5.0E-21
sp|Q94231|ARF11_CAEEL ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 14 155 7.0E-21
sp|Q54Y14|SAR1B_DICDI GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1 5 177 1.0E-20
sp|P40994|ARF3_YEAST ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 12 182 1.0E-20
sp|Q5R4G5|ARL6_PONAB ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 19 167 2.0E-20
sp|Q9H0F7|ARL6_HUMAN ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 19 167 2.0E-20
sp|A8INQ0|ARL13_CHLRE ADP-ribosylation factor-like protein 13B OS=Chlamydomonas reinhardtii GN=ARL13 PE=1 SV=1 1 177 3.0E-20
sp|Q54HK2|ARFF_DICDI ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 1 163 3.0E-20
sp|P36407|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 15 180 4.0E-20
sp|P0CT17|SAR1_MAGOY Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain Y34) GN=SAR1 PE=2 SV=1 8 179 5.0E-20
sp|P0CT16|SAR1_MAGO7 Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SAR1 PE=3 SV=1 8 179 5.0E-20
sp|Q8MQT8|SAR1_GIAIN GTP-binding protein Sar1 OS=Giardia intestinalis GN=SAR1 PE=3 SV=1 16 179 8.0E-20
sp|Q09767|ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 19 178 9.0E-20
sp|Q8BGX0|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 20 180 1.0E-19
sp|P36406|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 20 180 1.0E-19
sp|Q54I24|ARFD_DICDI ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 13 155 1.0E-19
sp|Q01474|SAR1B_ARATH GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=1 SV=1 8 179 2.0E-19
sp|Q9P4C8|SAR1_PICPG Small COPII coat GTPase SAR1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SAR1 PE=3 SV=1 16 179 3.0E-19
sp|P52884|SAR2_SOLLC GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1 11 179 4.0E-19
sp|Q23445|SAR1_CAEEL GTP-binding protein SAR1 OS=Caenorhabditis elegans GN=ZK180.4 PE=3 SV=1 8 179 4.0E-19
sp|Q9D4P0|ARL5B_MOUSE ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 8 180 4.0E-19
sp|Q96KC2|ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 8 180 4.0E-19
sp|P51646|ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 15 180 5.0E-19
sp|Q9Y689|ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 15 180 5.0E-19
sp|Q6P068|ARL5C_MOUSE ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 12 181 7.0E-19
sp|O04266|SAR1A_BRACM GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1 11 179 8.0E-19
sp|Q3SXC5|ARL14_MOUSE ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 18 179 9.0E-19
sp|Q4P0I7|SAR1_USTMA Small COPII coat GTPase SAR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SAR1 PE=3 SV=1 19 179 9.0E-19
sp|Q8N8L6|ARL10_HUMAN ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1 20 164 1.0E-18
sp|O04267|SAR1B_BRACM GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1 8 179 2.0E-18
sp|O04834|SAR1A_ARATH GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1 11 179 2.0E-18
sp|Q6CWR7|SAR1_KLULA Small COPII coat GTPase SAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SAR1 PE=3 SV=1 1 179 2.0E-18
sp|Q80ZU0|ARL5A_MOUSE ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 15 180 3.0E-18
sp|Q9Y6B6|SAR1B_HUMAN GTP-binding protein SAR1b OS=Homo sapiens GN=SAR1B PE=1 SV=1 16 179 3.0E-18
sp|P34212|ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 1 178 3.0E-18
sp|Q55AD9|ARL5_DICDI ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 3 177 3.0E-18
sp|Q3T0T7|SAR1B_BOVIN GTP-binding protein SAR1b OS=Bos taurus GN=SAR1B PE=2 SV=1 16 179 3.0E-18
sp|Q9CQC9|SAR1B_MOUSE GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1 16 179 4.0E-18
sp|Q9QVY3|SAR1B_CRIGR GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1 16 179 4.0E-18
sp|Q5REU3|ARL4D_PONAB ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1 23 133 4.0E-18
sp|P49703|ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=1 SV=2 23 133 4.0E-18
sp|Q6FUZ9|SAR1_CANGA Small COPII coat GTPase SAR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SAR1 PE=3 SV=1 16 179 4.0E-18
sp|Q5HZY2|SAR1B_RAT GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1 16 179 4.0E-18
sp|Q2KJ96|ARL5A_BOVIN ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 15 180 5.0E-18
sp|Q0VC18|ARL4D_BOVIN ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1 23 133 6.0E-18
sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus GN=Sar1a PE=1 SV=1 16 179 6.0E-18
sp|Q5PYH3|SAR1B_PIG GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1 16 179 6.0E-18
sp|Q52NJ3|SAR1A_PIG GTP-binding protein SAR1a OS=Sus scrofa GN=SAR1A PE=2 SV=1 16 179 7.0E-18
sp|Q3T0D7|SAR1A_BOVIN GTP-binding protein SAR1a OS=Bos taurus GN=SAR1A PE=2 SV=1 16 179 7.0E-18
sp|Q8BGR6|ARL15_MOUSE ADP-ribosylation factor-like protein 15 OS=Mus musculus GN=Arl15 PE=1 SV=1 20 153 7.0E-18
sp|P0C583|SAR1_NEUCR Small COPII coat GTPase sar1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vtr-7 PE=3 SV=1 8 179 8.0E-18
sp|Q18510|ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1 6 180 8.0E-18
sp|Q5R548|SAR1A_PONAB GTP-binding protein SAR1a OS=Pongo abelii GN=SAR1A PE=2 SV=1 16 179 9.0E-18
sp|Q9NR31|SAR1A_HUMAN GTP-binding protein SAR1a OS=Homo sapiens GN=SAR1A PE=1 SV=1 16 179 9.0E-18
sp|Q2HA55|SAR1_CHAGB Small COPII coat GTPase SAR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SAR1 PE=3 SV=2 8 178 9.0E-18
sp|P78976|SAR1_HYPJE Small COPII coat GTPase sar1 OS=Hypocrea jecorina GN=sar1 PE=3 SV=1 8 178 1.0E-17
sp|Q0UKC0|SAR1_PHANO Small COPII coat GTPase SAR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SAR1 PE=3 SV=2 16 179 1.0E-17
sp|Q6T311|ARL9_HUMAN ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1 19 155 2.0E-17
sp|Q01475|SAR1_SCHPO Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sar1 PE=1 SV=1 18 179 2.0E-17
sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 8 143 3.0E-17
sp|Q6CB54|SAR1_YARLI Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1 8 179 4.0E-17
sp|Q4WJS7|SAR1_ASPFU Small COPII coat GTPase sar1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sar1 PE=3 SV=1 16 179 4.0E-17
sp|A1D4D1|SAR1_NEOFI Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1 16 179 4.0E-17
sp|P20606|SAR1_YEAST Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1 16 179 4.0E-17
sp|Q60Z38|ARL6_CAEBR ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1 6 180 4.0E-17
sp|Q755D7|SAR1_ASHGO Small COPII coat GTPase SAR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SAR1 PE=3 SV=1 8 179 5.0E-17
sp|Q5EA19|ARL15_BOVIN ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1 20 153 6.0E-17
sp|P0C951|SAR1_ASPNC Small COPII coat GTPase SAR1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sar1 PE=3 SV=1 8 179 6.0E-17
sp|Q877B9|SAR1_ASPOR Small COPII coat GTPase sar1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sar1 PE=3 SV=1 16 179 7.0E-17
sp|Q8SQH8|ARF_ENCCU ADP-ribosylation factor OS=Encephalitozoon cuniculi (strain GB-M1) GN=ARF-1 PE=1 SV=3 16 148 9.0E-17
sp|Q0CUN7|SAR1_ASPTN Small COPII coat GTPase sar1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sar1 PE=3 SV=1 16 179 1.0E-16
sp|A1CRG9|SAR1_ASPCL Small COPII coat GTPase sar1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sar1 PE=3 SV=1 16 179 1.0E-16
sp|Q5RFN0|ARL15_PONAB ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1 20 153 1.0E-16
sp|Q9NXU5|ARL15_HUMAN ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1 20 153 1.0E-16
sp|Q5BGB9|SAR1_EMENI Small COPII coat GTPase sar1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sar1 PE=3 SV=1 16 179 2.0E-16
sp|Q54UF1|ARL2_DICDI ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 23 179 3.0E-16
sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 8 179 3.0E-16
sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=1 SV=2 8 179 3.0E-16
sp|Q6BVA7|SAR1_DEBHA Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SAR1 PE=3 SV=1 8 179 3.0E-16
sp|A3LTA2|SAR1_PICST Small COPII coat GTPase SAR1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SAR1 PE=3 SV=1 16 179 4.0E-16
sp|A5E5G3|SAR1_LODEL Small COPII coat GTPase SAR1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SAR1 PE=3 SV=2 9 179 5.0E-16
sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 8 154 5.0E-16
sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 8 179 7.0E-16
sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 8 179 7.0E-16
sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 8 179 7.0E-16
sp|Q640N2|AR13B_MOUSE ADP-ribosylation factor-like protein 13B OS=Mus musculus GN=Arl13b PE=1 SV=2 1 154 7.0E-16
sp|Q9QXJ4|ARL10_MOUSE ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=1 SV=2 19 149 8.0E-16
sp|Q59S78|SAR1_CANAL Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2 9 179 1.0E-15
sp|Q09654|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3 20 138 2.0E-15
sp|P0C950|SAR1_ASPNG Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1 8 179 2.0E-15
sp|A6NH57|ARL5C_HUMAN Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 12 181 3.0E-15
sp|A5DR82|SAR1_PICGU Small COPII coat GTPase SAR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SAR1 PE=3 SV=3 9 178 2.0E-14
sp|Q1ZXA5|ARLX_DICDI ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1 6 145 5.0E-13
sp|Q54YV7|ARFL_DICDI ADP-ribosylation factor L OS=Dictyostelium discoideum GN=arrL PE=3 SV=1 22 181 5.0E-12
sp|Q5RCQ6|ARL3_PONAB ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 19 179 5.0E-12
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 22 170 9.0E-12
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 22 170 1.0E-11
sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 19 136 1.0E-11
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 22 134 2.0E-11
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 22 180 3.0E-11
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 22 178 4.0E-11
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 19 180 4.0E-11
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 22 137 1.0E-10
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 22 178 1.0E-10
sp|P52885|SAR1_TOBAC GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1 11 179 1.0E-10
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 22 144 2.0E-10
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 22 180 2.0E-10
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 22 178 2.0E-10
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 22 134 2.0E-10
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 22 136 4.0E-10
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 23 139 5.0E-10
sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=1 SV=1 1 154 6.0E-10
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 18 140 6.0E-10
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 22 141 7.0E-10
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 22 138 8.0E-10
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 22 142 8.0E-10
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 25 137 8.0E-10
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 22 178 9.0E-10
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 22 178 1.0E-09
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 18 140 1.0E-09
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 22 134 1.0E-09
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 22 178 1.0E-09
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 22 142 1.0E-09
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 22 155 1.0E-09
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 22 136 1.0E-09
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 23 136 1.0E-09
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 22 142 1.0E-09
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 22 142 1.0E-09
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 22 142 1.0E-09
sp|Q8SS09|SAR1_ENCCU Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SAR1 PE=1 SV=1 16 139 1.0E-09
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 22 142 1.0E-09
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 22 142 1.0E-09
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 18 140 1.0E-09
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 25 140 2.0E-09
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 23 174 2.0E-09
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 23 139 2.0E-09
sp|H2L0N8|ARL13_CAEEL ADP-ribosylation factor-like protein 13B OS=Caenorhabditis elegans GN=arl-13 PE=1 SV=1 19 133 2.0E-09
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 18 140 2.0E-09
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 22 137 2.0E-09
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 22 181 3.0E-09
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 22 134 3.0E-09
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 22 134 3.0E-09
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 22 133 4.0E-09
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 22 133 4.0E-09
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 22 133 4.0E-09
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 22 180 4.0E-09
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 23 174 5.0E-09
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 23 174 5.0E-09
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 23 170 5.0E-09
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 22 180 5.0E-09
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 23 174 5.0E-09
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 22 142 6.0E-09
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 22 135 6.0E-09
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 23 174 6.0E-09
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 32 147 7.0E-09
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 22 136 7.0E-09
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 22 134 8.0E-09
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 22 134 8.0E-09
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 22 134 8.0E-09
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 22 134 8.0E-09
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 22 150 8.0E-09
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 22 134 8.0E-09
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 23 152 9.0E-09
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 22 142 1.0E-08
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 22 142 1.0E-08
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 22 142 1.0E-08
sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 16 136 1.0E-08
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 22 142 1.0E-08
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 22 136 1.0E-08
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 22 152 1.0E-08
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 22 136 1.0E-08
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 22 134 1.0E-08
sp|Q20365|RAB33_CAEEL Ras-related protein Rab-33 OS=Caenorhabditis elegans GN=rab-33 PE=2 SV=1 22 134 1.0E-08
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 12 143 1.0E-08
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 22 150 1.0E-08
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 22 150 1.0E-08
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 19 136 1.0E-08
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 22 136 1.0E-08
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 22 134 1.0E-08
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 22 135 2.0E-08
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 22 134 2.0E-08
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 23 174 2.0E-08
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 22 137 2.0E-08
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 22 134 2.0E-08
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 22 150 2.0E-08
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 22 150 2.0E-08
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 22 150 2.0E-08
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 22 136 2.0E-08
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 22 150 2.0E-08
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 47 180 2.0E-08
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 22 181 2.0E-08
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 23 174 2.0E-08
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 22 135 3.0E-08
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 22 137 3.0E-08
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 22 140 3.0E-08
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 22 135 3.0E-08
sp|Q5H913|AR13A_HUMAN ADP-ribosylation factor-like protein 13A OS=Homo sapiens GN=ARL13A PE=2 SV=2 19 177 3.0E-08
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 22 142 3.0E-08
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 21 140 3.0E-08
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 22 136 3.0E-08
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 22 135 3.0E-08
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 22 135 3.0E-08
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 22 135 3.0E-08
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 22 135 3.0E-08
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 22 134 3.0E-08
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 22 171 4.0E-08
sp|Q6AXT3|AR13A_RAT ADP-ribosylation factor-like protein 13A OS=Rattus norvegicus GN=Arl13a PE=2 SV=1 19 177 4.0E-08
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 22 136 4.0E-08
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 22 142 4.0E-08
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 22 171 5.0E-08
sp|P87027|SPG1_SCHPO Septum-promoting GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spg1 PE=1 SV=1 22 133 5.0E-08
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 22 133 5.0E-08
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 21 140 5.0E-08
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 19 145 5.0E-08
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 22 133 5.0E-08
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 22 171 5.0E-08
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 22 171 5.0E-08
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 22 171 5.0E-08
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 23 180 6.0E-08
sp|Q9P8V0|RHO4_ASHGO GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 22 134 7.0E-08
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 22 140 7.0E-08
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 22 133 8.0E-08
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 10 134 9.0E-08
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 22 135 1.0E-07
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 22 140 1.0E-07
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 20 134 1.0E-07
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 22 136 1.0E-07
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 22 134 1.0E-07
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 20 134 1.0E-07
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 22 133 1.0E-07
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 22 142 1.0E-07
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 22 134 1.0E-07
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 20 134 1.0E-07
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 20 134 1.0E-07
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 20 134 1.0E-07
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 25 140 1.0E-07
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 22 134 1.0E-07
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 22 134 1.0E-07
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 13 136 1.0E-07
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 25 142 1.0E-07
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 22 135 1.0E-07
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 22 182 1.0E-07
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 22 178 1.0E-07
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 25 142 1.0E-07
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 22 134 1.0E-07
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 22 134 1.0E-07
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 22 137 1.0E-07
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 22 137 2.0E-07
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 13 146 2.0E-07
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 25 142 2.0E-07
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 20 134 2.0E-07
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 20 134 2.0E-07
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 20 134 2.0E-07
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 20 134 2.0E-07
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 20 134 2.0E-07
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 22 134 2.0E-07
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 13 146 2.0E-07
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 22 182 2.0E-07
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 13 146 2.0E-07
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 22 133 2.0E-07
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 22 137 2.0E-07
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 22 133 3.0E-07
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 22 133 3.0E-07
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 19 141 3.0E-07
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 13 135 3.0E-07
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 22 137 3.0E-07
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 22 139 3.0E-07
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 22 135 3.0E-07
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 22 178 3.0E-07
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 25 142 3.0E-07
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 25 142 3.0E-07
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 22 135 3.0E-07
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 22 135 3.0E-07
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 19 141 4.0E-07
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 22 142 4.0E-07
sp|Q9D416|AR13A_MOUSE ADP-ribosylation factor-like protein 13A OS=Mus musculus GN=Arl13a PE=2 SV=1 23 177 4.0E-07
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 16 179 4.0E-07
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 17 137 4.0E-07
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 25 142 4.0E-07
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 22 135 4.0E-07
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 21 141 4.0E-07
sp|P38545|RAN_PLAFA GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 20 180 4.0E-07
sp|P51157|RAB28_HUMAN Ras-related protein Rab-28 OS=Homo sapiens GN=RAB28 PE=1 SV=2 19 138 4.0E-07
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 17 134 4.0E-07
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 22 133 5.0E-07
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 23 136 5.0E-07
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 22 178 5.0E-07
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 22 178 5.0E-07
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 22 178 5.0E-07
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 18 139 5.0E-07
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 14 140 5.0E-07
sp|Q8MXQ2|RB32C_DICDI Ras-related protein Rab-32C OS=Dictyostelium discoideum GN=rab32C PE=3 SV=2 22 134 5.0E-07
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 22 136 5.0E-07
sp|Q9VND8|RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 18 140 5.0E-07
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 19 135 5.0E-07
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 19 178 5.0E-07
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 17 142 6.0E-07
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 17 142 6.0E-07
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 13 146 6.0E-07
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 17 142 6.0E-07
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 20 142 7.0E-07
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 22 135 7.0E-07
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 17 142 7.0E-07
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 20 134 7.0E-07
sp|Q99KL7|RAB28_MOUSE Ras-related protein Rab-28 OS=Mus musculus GN=Rab28 PE=1 SV=1 19 141 7.0E-07
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 1 138 8.0E-07
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 22 137 8.0E-07
sp|Q5RFI2|RAB28_PONAB Ras-related protein Rab-28 OS=Pongo abelii GN=RAB28 PE=2 SV=1 19 138 8.0E-07
sp|P51158|RAB28_RAT Ras-related protein Rab-28 OS=Rattus norvegicus GN=Rab28 PE=2 SV=1 19 141 8.0E-07
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 22 137 9.0E-07
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 19 174 9.0E-07
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 22 105 9.0E-07
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 27 141 9.0E-07
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 17 142 9.0E-07
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 19 141 9.0E-07
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 22 137 1.0E-06
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 18 135 1.0E-06
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 18 135 1.0E-06
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 22 133 1.0E-06
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 18 135 1.0E-06
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 13 180 1.0E-06
sp|Q56JV3|RHEB_BOVIN GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 18 135 1.0E-06
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 20 134 1.0E-06
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 19 136 1.0E-06
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 18 170 1.0E-06
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 20 134 1.0E-06
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 20 134 1.0E-06
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 22 133 1.0E-06
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 22 133 1.0E-06
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 20 134 1.0E-06
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 20 134 1.0E-06
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 20 134 1.0E-06
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 22 133 1.0E-06
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 22 147 2.0E-06
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 18 174 2.0E-06
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 22 138 2.0E-06
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 22 133 2.0E-06
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 22 142 2.0E-06
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 22 133 2.0E-06
sp|Q3SWY9|RAB28_BOVIN Ras-related protein Rab-28 OS=Bos taurus GN=RAB28 PE=2 SV=1 17 141 2.0E-06
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 13 142 2.0E-06
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 19 147 2.0E-06
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 19 134 2.0E-06
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 22 182 2.0E-06
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 17 134 2.0E-06
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 22 137 2.0E-06
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 22 180 2.0E-06
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 22 134 2.0E-06
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 22 134 2.0E-06
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 17 137 2.0E-06
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 17 137 2.0E-06
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 22 137 2.0E-06
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 22 137 2.0E-06
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 22 137 2.0E-06
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 22 179 2.0E-06
sp|P41914|RAN_TETPY GTP-binding nuclear protein Ran OS=Tetrahymena pyriformis PE=2 SV=1 22 180 2.0E-06
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 22 179 3.0E-06
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 21 140 3.0E-06
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 22 137 3.0E-06
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 18 174 3.0E-06
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 25 142 3.0E-06
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 25 140 3.0E-06
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 25 140 3.0E-06
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 25 135 3.0E-06
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 25 142 3.0E-06
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 25 140 3.0E-06
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 25 140 3.0E-06
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 25 142 3.0E-06
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 25 142 3.0E-06
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 25 142 3.0E-06
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 25 142 3.0E-06
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 25 142 3.0E-06
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 20 145 4.0E-06
sp|Q550Q4|RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 19 177 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102880
MAGLFLSFFHWLSGIFFSKQAEIAVVGLQASGKTSFVNVITSGQWSEDVVPTVAFNFRKVRKENVTMKIWDVAGQ
PKFRSMWERYCNGVDAIVYVVDSADSDKFNTARFELHQLLSQSSLAGVPLLVLGNKNDLNEHVPVKQLIKDLQLD
KITDRPVSCYSCSMKSQHNLDIILKWLAEKSH*
Coding >AgabiH97|102880
ATGGCCGGCCTCTTTCTCTCCTTTTTCCACTGGCTTTCTGGTATCTTCTTCTCAAAACAAGCAGAAATCGCCGTT
GTCGGGCTCCAAGCTTCGGGAAAGACATCTTTTGTCAACGTTATCACTTCTGGCCAATGGAGTGAAGACGTCGTA
CCCACCGTAGCTTTCAACTTTCGCAAGGTCAGAAAAGAAAATGTAACAATGAAAATCTGGGATGTCGCTGGCCAG
CCTAAATTCAGGTCAATGTGGGAACGATACTGCAATGGAGTCGACGCTATAGTTTATGTAGTCGACTCGGCAGAC
TCCGACAAGTTTAATACAGCCCGATTCGAGCTCCATCAATTGCTCTCTCAATCGTCCTTGGCAGGCGTCCCTCTA
TTAGTCCTGGGTAACAAGAACGATTTGAATGAACATGTACCTGTAAAGCAGCTCATTAAAGATCTGCAACTGGAC
AAAATTACCGACCGGCCTGTATCATGCTACTCGTGTTCTATGAAGAGCCAACATAATCTAGATATCATCCTAAAA
TGGCTGGCCGAGAAAAGTCATTAA
Transcript >AgabiH97|102880
ATGGCCGGCCTCTTTCTCTCCTTTTTCCACTGGCTTTCTGGTATCTTCTTCTCAAAACAAGCAGAAATCGCCGTT
GTCGGGCTCCAAGCTTCGGGAAAGACATCTTTTGTCAACGTTATCACTTCTGGCCAATGGAGTGAAGACGTCGTA
CCCACCGTAGCTTTCAACTTTCGCAAGGTCAGAAAAGAAAATGTAACAATGAAAATCTGGGATGTCGCTGGCCAG
CCTAAATTCAGGTCAATGTGGGAACGATACTGCAATGGAGTCGACGCTATAGTTTATGTAGTCGACTCGGCAGAC
TCCGACAAGTTTAATACAGCCCGATTCGAGCTCCATCAATTGCTCTCTCAATCGTCCTTGGCAGGCGTCCCTCTA
TTAGTCCTGGGTAACAAGAACGATTTGAATGAACATGTACCTGTAAAGCAGCTCATTAAAGATCTGCAACTGGAC
AAAATTACCGACCGGCCTGTATCATGCTACTCGTGTTCTATGAAGAGCCAACATAATCTAGATATCATCCTAAAA
TGGCTGGCCGAGAAAAGTCATTAA
Gene >AgabiH97|102880
ATGGCCGGCCTCTTTCTCTCCTTTTTCCACTGGCTTTCTGGGTGCGTAGTATATGCCTCTACTACAATCTCCTGC
TCATCCACGCCCTAGTATCTTCTTCTCAAAACAAGCAGAAATCGCCGTTGTCGGGCTCCAAGTAATACTACTCCT
CGCCCGTCTCTCTTCCACACATCTAAAACAGCTCAACAGGCTTCGGGAAAGACATCTTTTGTCAACGTTATCACT
TCTGGCCAAGTACAAGCAAGCCACTCACTGCTCTATTCTTATCTAATGCTTCCGTAGTGGAGTGAAGACGTCGTA
CCCACCGTAGCTTTCAACTTTCGCAAGGTCAGAAAAGAAAATGTAACAATGAAAATCTGGGATGTCGCTGGTACG
TCCGATTTTCTCTTCTCCTCGCTGCATACAACTTTCTGTCCCCACAGGCCAGCCTAAATTCAGGTCAATGTGGGA
ACGATACTGCAATGGAGTCGACGCTATAGTGTGTGTACATCTACCTACAAGCCGTCTAGCCTCATCTTACCTTAT
CCAACAAGTTATGTAGTCGACTCGGCAGACGTACGTCACTCTCTCTGCCTCAGCTTTCTATCGCCCTCAACCCAT
CTCCTAGTCCGACAAGTTTAATACAGCCCGATTCGAGCTCCATCAATTGCTCTCTCAATCGTCCTTGGCAGGCGT
CCCTCTATTAGTCGTATGTTTTGTTTCGTATTACTCGGCGTTCCTCATGCGGTCATCTTTAATAGCTGGGTAACA
AGAACGATTTGAATGAACATGTACCTGTAAAGCAGCTCATTAAAGATCTGTAAGTTCAAGTCCTTGTTTCAGCTT
CACTTCATGAGACCTTGCCAGGCAACTGGACAAAATTACCGACCGGCCTGTATCAGTGAGTACCCTTGTCCTCTA
CTCACCAACGAGACACTCACCATCCGCTTGTAAACAGTGCTACTCGGTGAGCCACCATATACATACACTCCACCA
ACCAACTAAATCACCTTGAACCCAGTGTTCTATGAAGAGCCAACATAATCTGTGCGTATTTCACCCATGGTCACT
TTCGTAGCTTCTCACTCCTGCTCAGAGATATCATCCTAAAATGGCTGGCCGAGAAAAGTCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail