Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102730
Gene name
Locationscaffold_7:1430033..1431036
Strand-
Gene length (bp)1003
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.1E-77 49 298
PF13649 Methyltransf_25 Methyltransferase domain 1.9E-13 100 206
PF08241 Methyltransf_11 Methyltransferase domain 4.5E-11 101 210
PF08242 Methyltransf_12 Methyltransferase domain 9.2E-10 101 208
PF13489 Methyltransf_23 Methyltransferase domain 2.4E-09 84 273
PF13847 Methyltransf_31 Methyltransferase domain 6.0E-09 98 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87230|COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq5 PE=3 SV=1 21 299 6.0E-97
sp|Q54VN2|COQ5_DICDI 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Dictyostelium discoideum GN=coq5 PE=3 SV=1 34 299 7.0E-86
sp|Q0P5A2|COQ5_BOVIN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Bos taurus GN=COQ5 PE=2 SV=1 10 299 8.0E-81
sp|Q66L51|COQ5_DANRE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Danio rerio GN=coq5 PE=2 SV=1 10 299 1.0E-79
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 24 299 3.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87230|COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq5 PE=3 SV=1 21 299 6.0E-97
sp|Q54VN2|COQ5_DICDI 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Dictyostelium discoideum GN=coq5 PE=3 SV=1 34 299 7.0E-86
sp|Q0P5A2|COQ5_BOVIN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Bos taurus GN=COQ5 PE=2 SV=1 10 299 8.0E-81
sp|Q66L51|COQ5_DANRE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Danio rerio GN=coq5 PE=2 SV=1 10 299 1.0E-79
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 24 299 3.0E-79
sp|P49017|COQ5_YEAST 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ5 PE=1 SV=1 5 299 7.0E-79
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 40 299 2.0E-77
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 24 299 2.0E-77
sp|Q2J2H9|UBIE_RHOP2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain HaA2) GN=ubiE PE=3 SV=1 34 299 2.0E-77
sp|Q16DL1|UBIE_ROSDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiE PE=3 SV=1 37 299 2.0E-77
sp|Q9LVC8|COQ5_ARATH 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Arabidopsis thaliana GN=COQ5 PE=2 SV=1 15 299 3.0E-77
sp|Q13EN8|UBIE_RHOPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain BisB5) GN=ubiE PE=3 SV=1 38 299 4.0E-77
sp|Q5ZLL5|COQ5_CHICK 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Gallus gallus GN=COQ5 PE=2 SV=1 9 299 5.0E-77
sp|Q5HYK3|COQ5_HUMAN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens GN=COQ5 PE=1 SV=2 22 299 7.0E-77
sp|Q4G064|COQ5_RAT 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Rattus norvegicus GN=Coq5 PE=2 SV=1 10 299 1.0E-76
sp|A9ILA7|UBIE_BART1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 28 299 4.0E-76
sp|Q5JNC0|COQ5_ORYSJ 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Oryza sativa subsp. japonica GN=COQ5 PE=2 SV=1 18 299 1.0E-75
sp|Q6G577|UBIE_BARHE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiE PE=3 SV=1 28 299 3.0E-75
sp|Q9VYF8|COQ5_DROME 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Drosophila melanogaster GN=Coq5 PE=2 SV=1 14 299 4.0E-75
sp|Q4V7R3|COQ5_XENLA 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Xenopus laevis GN=coq5 PE=2 SV=1 1 299 4.0E-75
sp|Q9CXI0|COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus GN=Coq5 PE=1 SV=2 10 299 5.0E-75
sp|B3Q619|UBIE_RHOPT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiE PE=3 SV=1 34 299 9.0E-75
sp|Q6NDM2|UBIE_RHOPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiE PE=3 SV=1 34 299 9.0E-75
sp|Q5RBK6|COQ5_PONAB 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Pongo abelii GN=COQ5 PE=2 SV=1 41 299 1.0E-74
sp|A1BAN1|UBIE_PARDP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Paracoccus denitrificans (strain Pd 1222) GN=ubiE PE=3 SV=1 35 299 1.0E-74
sp|Q6G1I2|UBIE_BARQU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella quintana (strain Toulouse) GN=ubiE PE=3 SV=1 28 299 2.0E-74
sp|A6UFF7|UBIE_SINMW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Sinorhizobium medicae (strain WSM419) GN=ubiE PE=3 SV=1 26 299 2.0E-74
sp|A1UUE1|UBIE_BARBK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ubiE PE=3 SV=1 28 299 4.0E-74
sp|Q1MME0|UBIE_RHIL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ubiE PE=3 SV=1 26 299 1.0E-73
sp|Q2KDB0|UBIE_RHIEC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ubiE PE=3 SV=1 26 299 2.0E-73
sp|P34666|COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans GN=coq-5 PE=3 SV=2 14 298 2.0E-73
sp|C3MCY6|UBIE_RHISN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium sp. (strain NGR234) GN=ubiE PE=3 SV=1 26 299 2.0E-73
sp|Q92SK7|UBIE_RHIME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 26 299 2.0E-73
sp|B3PZ92|UBIE_RHIE6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium etli (strain CIAT 652) GN=ubiE PE=3 SV=1 26 299 3.0E-73
sp|A8LNK7|UBIE_DINSH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ubiE PE=3 SV=1 32 299 3.0E-73
sp|Q89WD0|UBIE_BRADU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ubiE PE=3 SV=1 38 299 6.0E-73
sp|B9JZF4|UBIE_AGRVS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ubiE PE=3 SV=1 26 299 7.0E-73
sp|Q8UIH5|UBIE_AGRFC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ubiE PE=3 SV=1 26 299 8.0E-73
sp|B8IJ00|UBIE_METNO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ubiE PE=3 SV=1 38 299 1.0E-72
sp|B9KQJ8|UBIE_RHOSK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiE PE=3 SV=1 32 299 2.0E-72
sp|Q3IY65|UBIE_RHOS4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiE PE=3 SV=1 32 299 2.0E-72
sp|A3PFL1|UBIE_RHOS1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiE PE=3 SV=1 32 299 2.0E-72
sp|B9J7S8|UBIE_AGRRK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ubiE PE=3 SV=1 26 299 2.0E-72
sp|Q1QS47|UBIE_NITHX Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ubiE PE=3 SV=1 38 299 4.0E-72
sp|A4WVR7|UBIE_RHOS5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiE PE=3 SV=1 38 299 7.0E-72
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 26 299 1.0E-71
sp|Q9A258|UBIE_CAUCR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ubiE PE=3 SV=1 38 296 2.0E-71
sp|B8GVY5|UBIE_CAUCN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ubiE PE=3 SV=1 38 296 2.0E-71
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 38 299 4.0E-71
sp|A5E888|UBIE_BRASB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ubiE PE=3 SV=1 37 299 2.0E-70
sp|B0T7D0|UBIE_CAUSK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Caulobacter sp. (strain K31) GN=ubiE PE=3 SV=1 38 296 3.0E-70
sp|B5ZYK8|UBIE_RHILW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ubiE PE=3 SV=1 26 299 3.0E-70
sp|A8GPI0|UBIE_RICAH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia akari (strain Hartford) GN=ubiE PE=3 SV=1 41 299 2.0E-69
sp|A4YJH0|UBIE_BRASO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bradyrhizobium sp. (strain ORS278) GN=ubiE PE=3 SV=1 37 299 3.0E-69
sp|B4RC42|UBIE_PHEZH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Phenylobacterium zucineum (strain HLK1) GN=ubiE PE=3 SV=1 38 296 9.0E-68
sp|C3PLF4|UBIE_RICAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia africae (strain ESF-5) GN=ubiE PE=3 SV=1 40 296 2.0E-67
sp|A8GT99|UBIE_RICRS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia rickettsii (strain Sheila Smith) GN=ubiE PE=3 SV=1 40 296 2.0E-67
sp|B0BUT9|UBIE_RICRO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia rickettsii (strain Iowa) GN=ubiE PE=3 SV=1 40 296 2.0E-67
sp|Q92GT5|UBIE_RICCN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ubiE PE=3 SV=1 40 296 2.0E-67
sp|A8GXR2|UBIE_RICB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia bellii (strain OSU 85-389) GN=ubiE PE=3 SV=1 40 299 2.0E-67
sp|Q1RJY5|UBIE_RICBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia bellii (strain RML369-C) GN=ubiE PE=3 SV=1 40 299 2.0E-67
sp|Q9ZCP3|UBIE_RICPR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia prowazekii (strain Madrid E) GN=ubiE PE=3 SV=2 38 299 6.0E-67
sp|A8F2G9|UBIE_RICM5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia massiliae (strain Mtu5) GN=ubiE PE=3 SV=1 40 296 2.0E-66
sp|C4K2K3|UBIE_RICPU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia peacockii (strain Rustic) GN=ubiE PE=3 SV=1 40 296 3.0E-66
sp|Q4UMW4|UBIE_RICFE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ubiE PE=3 SV=1 40 299 5.0E-66
sp|A5FZ96|UBIE_ACICJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Acidiphilium cryptum (strain JF-5) GN=ubiE PE=3 SV=1 38 299 2.0E-65
sp|A8EZP4|UBIE_RICCK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia canadensis (strain McKiel) GN=ubiE PE=3 SV=1 40 299 2.0E-64
sp|Q3IJV7|UBIE_PSEHT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiE PE=3 SV=1 32 298 6.0E-64
sp|C0R2Q3|UBIE_WOLWR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=ubiE PE=3 SV=1 45 298 1.0E-63
sp|Q68W57|UBIE_RICTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ubiE PE=3 SV=1 40 299 1.0E-63
sp|P55905|COQ5_LEIDO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Leishmania donovani PE=2 SV=1 52 298 1.0E-63
sp|Q9X3X2|UBIE_ZYMMO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ubiE PE=3 SV=2 40 299 2.0E-63
sp|B0TZP1|UBIE_FRAP2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ubiE PE=3 SV=1 33 298 9.0E-63
sp|Q73HZ4|UBIE_WOLPM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Wolbachia pipientis wMel GN=ubiE PE=3 SV=1 45 298 1.0E-62
sp|A0Q549|UBIE_FRATN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. novicida (strain U112) GN=ubiE PE=3 SV=1 33 298 2.0E-62
sp|B2SFA2|UBIE_FRATM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ubiE PE=3 SV=1 33 298 3.0E-62
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 34 298 8.0E-62
sp|Q5NFE1|UBIE_FRATT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ubiE PE=3 SV=1 33 298 9.0E-62
sp|Q14GU4|UBIE_FRAT1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ubiE PE=3 SV=1 33 298 9.0E-62
sp|A4IXH9|UBIE_FRATW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ubiE PE=3 SV=1 33 298 2.0E-61
sp|Q6DAQ7|UBIE_PECAS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiE PE=3 SV=1 32 298 4.0E-61
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 35 298 6.0E-61
sp|Q31IM5|UBIE_THICR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiE PE=3 SV=1 31 298 6.0E-61
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 32 298 6.0E-61
sp|Q0BNE2|UBIE_FRATO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ubiE PE=3 SV=1 33 298 7.0E-61
sp|Q2A524|UBIE_FRATH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ubiE PE=3 SV=1 33 298 7.0E-61
sp|A7NAA1|UBIE_FRATF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ubiE PE=3 SV=1 33 298 7.0E-61
sp|C6DI77|UBIE_PECCP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiE PE=3 SV=1 32 298 7.0E-61
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 26 298 9.0E-61
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 35 298 1.0E-60
sp|A1SRS4|UBIE_PSYIN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 32 298 4.0E-60
sp|B3PH48|UBIE_CELJU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cellvibrio japonicus (strain Ueda107) GN=ubiE PE=3 SV=1 34 298 6.0E-60
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 32 298 1.0E-59
sp|B2VG41|UBIE_ERWT9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 38 298 2.0E-59
sp|C3K8U4|UBIE_PSEFS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain SBW25) GN=ubiE PE=3 SV=1 26 298 2.0E-59
sp|A9N9F4|UBIE_COXBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiE PE=3 SV=1 37 298 3.0E-59
sp|Q83A90|UBIE_COXBU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiE PE=3 SV=1 37 298 4.0E-59
sp|A9KD75|UBIE_COXBN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiE PE=3 SV=1 37 298 4.0E-59
sp|B6J3P6|UBIE_COXB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiE PE=3 SV=1 37 298 4.0E-59
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 32 298 5.0E-59
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 32 298 5.0E-59
sp|Q3KJC5|UBIE_PSEPF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 26 298 1.0E-58
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 32 298 1.0E-58
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 32 298 1.0E-58
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 32 298 1.0E-58
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 38 298 2.0E-58
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 32 298 2.0E-58
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 32 298 2.0E-58
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 32 298 2.0E-58
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 32 298 2.0E-58
sp|C1DHS2|UBIE_AZOVD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 34 298 2.0E-58
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 32 298 3.0E-58
sp|B1J2S8|UBIE_PSEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 26 298 3.0E-58
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 29 298 3.0E-58
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 29 298 3.0E-58
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 29 298 3.0E-58
sp|Q7MZ81|UBIE_PHOLL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiE PE=3 SV=1 37 298 3.0E-58
sp|B4EWC9|UBIE_PROMH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Proteus mirabilis (strain HI4320) GN=ubiE PE=3 SV=1 38 298 7.0E-58
sp|B6J676|UBIE_COXB1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiE PE=3 SV=1 37 298 7.0E-58
sp|Q9Z439|UBIE_PSEPU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida GN=ubiE PE=3 SV=1 26 298 7.0E-58
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 26 298 7.0E-58
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 26 298 7.0E-58
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 32 298 8.0E-58
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 32 298 1.0E-57
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 26 298 1.0E-57
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 35 298 2.0E-57
sp|B0KM36|UBIE_PSEPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain GB-1) GN=ubiE PE=3 SV=1 26 298 2.0E-57
sp|Q606J9|UBIE_METCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ubiE PE=3 SV=1 38 298 3.0E-57
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 32 298 3.0E-57
sp|A8ACY2|UBIE_CITK8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 38 298 3.0E-57
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 32 298 4.0E-57
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 38 298 5.0E-57
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 38 298 5.0E-57
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 26 298 5.0E-57
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 26 298 5.0E-57
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 32 298 6.0E-57
sp|Q1I3T0|UBIE_PSEE4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 34 298 7.0E-57
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 32 298 8.0E-57
sp|A4VGE5|UBIE_PSEU5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas stutzeri (strain A1501) GN=ubiE PE=3 SV=1 29 298 9.0E-57
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 38 298 2.0E-56
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 38 298 6.0E-56
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 38 298 6.0E-56
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 32 298 6.0E-56
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 38 298 6.0E-56
sp|A1KT06|UBIE_NEIMF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ubiE PE=3 SV=1 41 298 7.0E-56
sp|Q3SM81|UBIE_THIDA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiE PE=3 SV=1 37 299 8.0E-56
sp|B4SJ34|UBIE_STRM5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Stenotrophomonas maltophilia (strain R551-3) GN=ubiE PE=3 SV=1 31 299 8.0E-56
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 34 298 1.0E-55
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 38 298 1.0E-55
sp|Q9K075|UBIE_NEIMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiE PE=3 SV=1 41 298 1.0E-55
sp|Q7NZD3|UBIE_CHRVO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiE PE=3 SV=2 37 298 2.0E-55
sp|B4RK11|UBIE_NEIG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ubiE PE=3 SV=1 41 298 2.0E-55
sp|Q5F9R9|UBIE_NEIG1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ubiE PE=3 SV=1 41 298 2.0E-55
sp|P59911|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 31 298 3.0E-55
sp|C5BCA4|UBIE_EDWI9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 36 298 3.0E-55
sp|Q9JV83|UBIE_NEIMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiE PE=3 SV=1 41 298 3.0E-55
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 38 298 4.0E-55
sp|Q9JPD1|UBIE_RUBGI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rubrivivax gelatinosus (strain NBRC 100245 / IL144) GN=ubiE PE=3 SV=2 36 295 5.0E-55
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 29 298 6.0E-55
sp|Q8PPP2|UBIE_XANAC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiE PE=3 SV=1 38 299 7.0E-55
sp|Q2NYW4|UBIE_XANOM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiE PE=3 SV=1 38 299 1.0E-54
sp|Q8P558|UBIE_XANCP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiE PE=3 SV=2 38 299 1.0E-54
sp|B2FUU6|UBIE_STRMK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Stenotrophomonas maltophilia (strain K279a) GN=ubiE PE=3 SV=1 31 299 1.0E-54
sp|A9M3A0|UBIE_NEIM0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiE PE=3 SV=1 41 298 2.0E-54
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 27 298 1.0E-53
sp|Q7VRJ1|UBIE_BLOFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Blochmannia floridanus GN=ubiE PE=3 SV=1 41 298 2.0E-53
sp|Q7W0H1|UBIE_BORPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiE PE=3 SV=1 31 299 2.0E-53
sp|Q7W3N6|UBIE_BORPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiE PE=3 SV=1 31 299 2.0E-53
sp|Q7WF12|UBIE_BORBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiE PE=3 SV=1 31 299 2.0E-53
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 38 298 4.0E-53
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 32 298 4.0E-53
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 32 298 4.0E-53
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 32 298 4.0E-53
sp|C1DCV3|UBIE_LARHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Laribacter hongkongensis (strain HLHK9) GN=ubiE PE=3 SV=1 37 299 5.0E-53
sp|Q2KUG1|UBIE_BORA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella avium (strain 197N) GN=ubiE PE=3 SV=1 41 299 6.0E-53
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 27 298 6.0E-53
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 23 298 8.0E-53
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 23 298 8.0E-53
sp|Q87DI1|UBIE_XYLFT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiE PE=3 SV=1 31 298 2.0E-52
sp|B2IA21|UBIE_XYLF2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain M23) GN=ubiE PE=3 SV=1 31 298 2.0E-52
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 32 298 2.0E-52
sp|Q21H69|UBIE_SACD2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiE PE=3 SV=1 34 298 2.0E-52
sp|B0U6V1|UBIE_XYLFM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain M12) GN=ubiE PE=3 SV=1 31 298 4.0E-52
sp|Q1LRG9|UBIE_CUPMC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ubiE PE=3 SV=1 41 298 2.0E-51
sp|Q9PD92|UBIE_XYLFA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain 9a5c) GN=ubiE PE=3 SV=1 31 298 2.0E-51
sp|Q81ZZ8|UBIE_NITEU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiE PE=3 SV=1 38 298 5.0E-51
sp|Q145P0|UBIE_BURXL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia xenovorans (strain LB400) GN=ubiE PE=3 SV=1 41 298 8.0E-51
sp|Q2Y6R0|UBIE_NITMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiE PE=3 SV=1 37 298 9.0E-51
sp|B2AH07|UBIE_CUPTR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ubiE PE=3 SV=1 41 298 1.0E-50
sp|Q5ZRH9|UBIE_LEGPH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ubiE PE=3 SV=1 33 298 4.0E-50
sp|B2UFG8|UBIE_RALPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia pickettii (strain 12J) GN=ubiE PE=3 SV=1 41 296 5.0E-50
sp|Q475X0|UBIE_CUPPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiE PE=3 SV=1 41 298 6.0E-50
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 41 296 6.0E-50
sp|Q5X0X6|UBIE_LEGPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Paris) GN=ubiE PE=3 SV=1 33 298 6.0E-50
sp|Q5WSQ8|UBIE_LEGPL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Lens) GN=ubiE PE=3 SV=1 33 298 6.0E-50
sp|Q0KEH6|UBIE_CUPNH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ubiE PE=3 SV=1 41 298 1.0E-49
sp|A5II90|UBIE_LEGPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Corby) GN=ubiE PE=3 SV=1 33 298 2.0E-49
sp|B2SX35|UBIE_BURPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiE PE=3 SV=1 41 298 2.0E-49
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|B2JCU8|UBIE_BURP8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiE PE=3 SV=1 41 298 3.0E-48
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 41 298 5.0E-47
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 41 298 2.0E-46
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 41 298 2.0E-46
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 41 298 2.0E-46
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 41 298 2.0E-46
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 41 298 3.0E-46
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 41 298 3.0E-46
sp|Q8D382|UBIE_WIGBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Wigglesworthia glossinidia brevipalpis GN=ubiE PE=3 SV=2 35 294 4.0E-46
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 41 298 4.0E-46
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 41 298 6.0E-46
sp|Q491V7|UBIE_BLOPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Blochmannia pennsylvanicus (strain BPEN) GN=ubiE PE=3 SV=1 31 298 3.0E-44
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 49 298 2.0E-36
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 49 298 7.0E-36
sp|Q8EXJ3|MENG_LEPIN Demethylmenaquinone methyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=menG PE=3 SV=1 42 273 1.0E-35
sp|Q75FL1|MENG_LEPIC Demethylmenaquinone methyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=menG PE=3 SV=1 42 273 1.0E-35
sp|Q8A005|MENG_BACTN Demethylmenaquinone methyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=menG PE=3 SV=1 51 272 1.0E-35
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 49 298 1.0E-35
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 49 298 1.0E-35
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 49 298 1.0E-35
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 49 298 1.0E-35
sp|Q6MHQ3|UBIE_BDEBA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 54 296 2.0E-35
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 49 298 1.0E-34
sp|A0QRH1|MENG_MYCS2 Demethylmenaquinone methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=menG PE=3 SV=1 55 298 1.0E-34
sp|A1R990|MENG_ARTAT Demethylmenaquinone methyltransferase OS=Arthrobacter aurescens (strain TC1) GN=menG PE=3 SV=1 49 298 1.0E-34
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 49 298 1.0E-34
sp|Q81ZX2|MENG_STRAW Demethylmenaquinone methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=menG PE=3 SV=1 55 298 4.0E-34
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 48 298 5.0E-34
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 55 298 1.0E-33
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 42 298 2.0E-33
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 55 298 4.0E-33
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 55 298 4.0E-33
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 55 298 4.0E-33
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 55 298 4.0E-33
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 55 298 4.0E-33
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 55 298 4.0E-33
sp|C4LL93|MENG_CORK4 Demethylmenaquinone methyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=menG PE=3 SV=1 49 298 5.0E-33
sp|A6L3D5|MENG_BACV8 Demethylmenaquinone methyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=menG PE=3 SV=1 48 272 9.0E-33
sp|A3PUJ1|MENG_MYCSJ Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain JLS) GN=menG PE=3 SV=1 55 298 2.0E-32
sp|Q64XV8|MENG_BACFR Demethylmenaquinone methyltransferase OS=Bacteroides fragilis (strain YCH46) GN=menG PE=3 SV=1 51 298 2.0E-32
sp|Q5LH04|MENG_BACFN Demethylmenaquinone methyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=menG PE=3 SV=1 51 298 2.0E-32
sp|Q9Z5E9|UBIE_PSEOL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) OS=Pseudomonas oleovorans GN=ubiE PE=3 SV=1 26 206 2.0E-32
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 55 298 2.0E-32
sp|Q1BE01|MENG_MYCSS Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 55 298 3.0E-32
sp|A1UAY5|MENG_MYCSK Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 55 298 3.0E-32
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 49 298 4.0E-32
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 55 274 4.0E-32
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 49 298 9.0E-32
sp|Q3A209|UBIE_PELCD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ubiE PE=3 SV=1 56 298 9.0E-32
sp|C5C0T0|MENG_BEUC1 Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 55 299 1.0E-31
sp|C6E4U6|UBIE_GEOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sp. (strain M21) GN=ubiE PE=3 SV=1 55 298 2.0E-31
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 48 298 2.0E-31
sp|A9WRT1|MENG_RENSM Demethylmenaquinone methyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=menG PE=3 SV=1 55 298 4.0E-31
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 49 298 4.0E-31
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 55 298 6.0E-31
sp|A5GA37|UBIE_GEOUR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter uraniireducens (strain Rf4) GN=ubiE PE=3 SV=1 55 298 6.0E-31
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 55 274 7.0E-31
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 49 298 7.0E-31
sp|A0PLV5|MENG_MYCUA Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 55 298 1.0E-30
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 49 298 1.0E-30
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 49 298 1.0E-30
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 48 299 2.0E-30
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 55 296 2.0E-30
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 49 298 2.0E-30
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 49 298 2.0E-30
sp|B9LZA9|UBIE_GEODF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ubiE PE=3 SV=1 55 298 3.0E-30
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 48 298 3.0E-30
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 50 298 3.0E-30
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 47 298 3.0E-30
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 55 298 4.0E-30
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 48 298 5.0E-30
sp|A5UVB2|MENG_ROSS1 Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 47 298 6.0E-30
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 49 298 6.0E-30
sp|A1T3S1|MENG_MYCVP Demethylmenaquinone methyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=menG PE=3 SV=1 55 298 8.0E-30
sp|Q74EU2|UBIE_GEOSL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ubiE PE=3 SV=1 55 298 8.0E-30
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 49 298 9.0E-30
sp|A4T183|MENG_MYCGI Demethylmenaquinone methyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=menG PE=3 SV=1 55 298 9.0E-30
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 48 298 2.0E-29
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 49 298 2.0E-29
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 49 298 3.0E-29
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 55 298 4.0E-29
sp|Q81ZV1|MENG_CHLCV Demethylmenaquinone methyltransferase OS=Chlamydophila caviae (strain GPIC) GN=menG PE=3 SV=1 55 276 4.0E-29
sp|Q8YLP4|MENG_NOSS1 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 55 275 5.0E-29
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 48 272 6.0E-29
sp|P59912|MENG_RHOBA Demethylmenaquinone methyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=menG PE=3 SV=1 26 298 8.0E-29
sp|B1W525|MENG_STRGG Demethylmenaquinone methyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=menG PE=3 SV=1 49 298 8.0E-29
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 48 298 1.0E-28
sp|Q7MVR7|MENG_PORGI Demethylmenaquinone methyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=menG PE=3 SV=1 51 298 2.0E-28
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 50 298 2.0E-28
sp|B2RJE9|MENG_PORG3 Demethylmenaquinone methyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=menG PE=3 SV=1 51 298 2.0E-28
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 48 298 2.0E-28
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 48 298 2.0E-28
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 48 298 2.0E-28
sp|B3QLI9|MENG_CHLP8 Demethylmenaquinone methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menG PE=3 SV=1 55 276 2.0E-28
sp|Q9CBA8|MENG_MYCLE Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 56 298 2.0E-28
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 58 296 5.0E-28
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 48 298 5.0E-28
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 48 298 5.0E-28
sp|B1MHC3|MENG_MYCA9 Demethylmenaquinone methyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=menG PE=3 SV=1 55 294 6.0E-28
sp|Q6MCB5|MENG_PARUW Demethylmenaquinone methyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=menG PE=3 SV=1 55 298 6.0E-28
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 55 275 1.0E-27
sp|B2IUM7|MENG_NOSP7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=menG PE=3 SV=1 55 272 4.0E-27
sp|Q8KF69|MENG_CHLTE Demethylmenaquinone methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menG PE=3 SV=1 55 276 4.0E-27
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 55 299 6.0E-27
sp|A4QBE5|MENG_CORGB Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain R) GN=menG PE=3 SV=1 55 298 6.0E-27
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 51 298 6.0E-27
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 49 298 9.0E-27
sp|Q8NT39|MENG_CORGL Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=menG PE=3 SV=1 55 298 1.0E-26
sp|C3PKL1|MENG_CORA7 Demethylmenaquinone methyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=menG PE=3 SV=1 49 298 3.0E-26
sp|B0RCZ0|MENG_CLAMS Demethylmenaquinone methyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=menG PE=3 SV=1 51 298 2.0E-25
sp|B1VEN4|MENG_CORU7 Demethylmenaquinone methyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=menG PE=3 SV=1 55 298 4.0E-25
sp|Q8FSB3|MENG_COREF Demethylmenaquinone methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=menG PE=3 SV=2 55 298 6.0E-25
sp|Q9PJW4|MENG_CHLMU Demethylmenaquinone methyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=menG PE=3 SV=2 55 272 1.0E-24
sp|Q6ANL3|UBIE_DESPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ubiE PE=3 SV=1 55 298 2.0E-24
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 49 272 2.0E-24
sp|Q253I8|MENG_CHLFF Demethylmenaquinone methyltransferase OS=Chlamydophila felis (strain Fe/C-56) GN=menG PE=3 SV=1 46 276 6.0E-24
sp|O84435|MENG_CHLTR Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=menG PE=3 SV=1 55 273 2.0E-23
sp|Q3KLS2|MENG_CHLTA Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=menG PE=3 SV=1 55 273 2.0E-23
sp|B0BC65|MENG_CHLTB Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=menG PE=3 SV=1 55 273 3.0E-23
sp|B0B800|MENG_CHLT2 Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=menG PE=3 SV=1 55 273 3.0E-23
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 46 298 4.0E-23
sp|Q9K2B6|MENG_CHLPN Demethylmenaquinone methyltransferase OS=Chlamydia pneumoniae GN=menG PE=3 SV=2 56 276 6.0E-23
sp|A8LCA4|MENG_FRASN Demethylmenaquinone methyltransferase OS=Frankia sp. (strain EAN1pec) GN=menG PE=3 SV=1 49 298 3.0E-22
sp|Q47LE2|MENG_THEFY Demethylmenaquinone methyltransferase OS=Thermobifida fusca (strain YX) GN=menG PE=3 SV=1 56 294 5.0E-21
sp|Q5N4X9|MENG_SYNP6 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 55 282 4.0E-20
sp|Q31P90|MENG_SYNE7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 55 282 4.0E-20
sp|A8FKB3|UBIE_CAMJ8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ubiE PE=3 SV=1 51 273 5.0E-20
sp|Q9WZL2|MENG_THEMA Demethylmenaquinone methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=menG PE=3 SV=1 58 274 2.0E-19
sp|Q5HWE7|UBIE_CAMJR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Campylobacter jejuni (strain RM1221) GN=ubiE PE=3 SV=1 51 273 2.0E-18
sp|A1VY43|UBIE_CAMJJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ubiE PE=3 SV=1 51 273 2.0E-18
sp|P72818|MENG_SYNY3 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=menG PE=3 SV=1 55 272 3.0E-18
sp|Q9PIH5|UBIE_CAMJE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ubiE PE=3 SV=1 51 273 5.0E-18
sp|Q8DGE4|MENG_THEEB 2-phytyl-1,4-naphtoquinone methyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=menG PE=3 SV=1 55 276 2.0E-17
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 55 298 5.0E-17
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 55 298 5.0E-17
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 56 275 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102730
MQAFVRPHLCRTPRTLRRVTSGLRSLSTQRQSTSEPRTASFGFQTVPEEAKEGMVRDVFDSVAAKYDLMNDASSL
GVHRLWKDEFVASLRPGRRGPQKCIDVAGGTGDIALRILDFAREKYACRDTTVDVVDINSQMLKEGVKRFKKTMY
HNTPQISFTEGNAQQLSPEQFPDNAYDLYTIAFGIRNCTSIPSVLQEAHRVLRPGGTFACLEFSRVDNPILSTLY
DQYSFTVIPLLGTILAGDRGSYQYLVESIRKFPPQADFAQMIRDAGFKTGKDVDGAAWVNLWGGIACVHTGVKV*
Coding >AgabiH97|102730
ATGCAGGCTTTTGTCAGACCTCACTTATGCCGAACACCTAGAACTCTTCGCCGGGTGACATCAGGGTTGCGCTCA
TTATCTACGCAAAGGCAGTCTACATCGGAACCTCGCACAGCTTCCTTTGGTTTCCAAACCGTGCCAGAAGAGGCC
AAGGAGGGCATGGTCCGAGACGTGTTCGACTCTGTGGCTGCCAAGTATGATCTTATGAACGACGCTTCATCGTTG
GGGGTTCATAGACTATGGAAAGACGAGTTCGTTGCTTCGCTGCGTCCTGGCAGGCGAGGGCCCCAGAAATGTATT
GACGTTGCTGGTGGAACCGGCGACATAGCCCTTCGCATTCTTGACTTTGCGCGAGAGAAGTATGCGTGTAGGGAC
ACCACCGTGGATGTCGTGGATATCAACTCGCAGATGTTGAAAGAAGGAGTCAAGCGGTTTAAAAAGACTATGTAT
CATAATACACCCCAAATCTCCTTCACGGAAGGCAATGCGCAACAGCTCTCTCCAGAGCAATTCCCTGATAATGCG
TATGACCTCTACACAATTGCTTTTGGCATACGCAATTGCACATCAATACCCTCCGTTTTGCAAGAGGCCCACCGC
GTCCTCAGACCCGGTGGAACGTTCGCTTGCTTGGAATTTAGCAGGGTCGATAACCCGATTCTGAGCACCCTGTAC
GACCAATACTCGTTTACGGTCATTCCGCTGTTGGGAACAATACTCGCTGGAGATAGAGGGTCGTATCAATATCTG
GTGGAGTCAATTCGGAAATTCCCCCCGCAGGCAGATTTTGCGCAGATGATCAGGGATGCAGGATTCAAGACTGGG
AAGGATGTAGACGGCGCGGCATGGGTCAATTTGTGGGGAGGCATTGCGTGCGTGCACACCGGTGTCAAGGTGTAG
Transcript >AgabiH97|102730
ATGCAGGCTTTTGTCAGACCTCACTTATGCCGAACACCTAGAACTCTTCGCCGGGTGACATCAGGGTTGCGCTCA
TTATCTACGCAAAGGCAGTCTACATCGGAACCTCGCACAGCTTCCTTTGGTTTCCAAACCGTGCCAGAAGAGGCC
AAGGAGGGCATGGTCCGAGACGTGTTCGACTCTGTGGCTGCCAAGTATGATCTTATGAACGACGCTTCATCGTTG
GGGGTTCATAGACTATGGAAAGACGAGTTCGTTGCTTCGCTGCGTCCTGGCAGGCGAGGGCCCCAGAAATGTATT
GACGTTGCTGGTGGAACCGGCGACATAGCCCTTCGCATTCTTGACTTTGCGCGAGAGAAGTATGCGTGTAGGGAC
ACCACCGTGGATGTCGTGGATATCAACTCGCAGATGTTGAAAGAAGGAGTCAAGCGGTTTAAAAAGACTATGTAT
CATAATACACCCCAAATCTCCTTCACGGAAGGCAATGCGCAACAGCTCTCTCCAGAGCAATTCCCTGATAATGCG
TATGACCTCTACACAATTGCTTTTGGCATACGCAATTGCACATCAATACCCTCCGTTTTGCAAGAGGCCCACCGC
GTCCTCAGACCCGGTGGAACGTTCGCTTGCTTGGAATTTAGCAGGGTCGATAACCCGATTCTGAGCACCCTGTAC
GACCAATACTCGTTTACGGTCATTCCGCTGTTGGGAACAATACTCGCTGGAGATAGAGGGTCGTATCAATATCTG
GTGGAGTCAATTCGGAAATTCCCCCCGCAGGCAGATTTTGCGCAGATGATCAGGGATGCAGGATTCAAGACTGGG
AAGGATGTAGACGGCGCGGCATGGGTCAATTTGTGGGGAGGCATTGCGTGCGTGCACACCGGTGTCAAGGTGTAG
Gene >AgabiH97|102730
ATGCAGGCTTTTGTCAGACCTCACTTATGCCGAACACCTAGAACTCTTCGCCGGGTGACATCAGGGTTGCGCTCA
TTATCTACGCAAAGGCAGTCTACATCGGAACCTCGCACAGCTTCCTTTGGTTTCCAAACCGTGCCAGAAGAGGCC
AAGGAGGGCATGGTCCGAGACGTGTTCGACTCTGTGGCTGCCAAGTATGATCTTATGAACGACGCTTCATCGTTG
GGGGTTCATAGACTATGGAAAGACGAGTTCGTTGCTTCGCTGCGTCCTGGCAGGCGAGGGCCCCAGAAATGTATT
GACGTTGCTGGTGGAACCGGCGACATAGCCCTTCGCATTCTTGACTTTGCGCGAGAGAAGTATGCGTGTAGGGAC
ACCACCGTGGATGTCGTGGATATCAACTCGCAGATGTTGAAAGAAGGAGTCAAGCGGTTTAAAAAGACTATGTAT
CATAATAGTGAGTCCCTTCCTTGTACCTCTATTGGTAAGGCTCTCAATATTGCACTCAGCACCCCAAATCTCCTT
CACGGAAGGCAATGCGCAACAGCTCTCTCCAGAGCAATTCCCTGATAATGCGTATGACCTCTACACAATTGCTTT
TGGCATACGCAATTGCACATCAATACCCTCCGTTTTGCAAGAGGCCCACCGCGTCCTCAGACCCGGTGGAACGTT
CGCTTGCTTGGAATTTAGCAGGGTCGATAACCCGATTCTGAGCACGTAGGTGACGCACTAGTCGTGAATGTTCTG
CTTTTGAAATATTTTGCATAGCCTGTACGACCAATACTCGTTTACGGTCATTCCGCTGTTGGGAACAATACTCGC
TGGAGATAGAGGGTCGTATCAATATCTGGTGGAGTCAATTCGGAAATTCCCCCCGCAGGCAGATTTTGCGCAGAT
GATCAGGGATGCAGGATTCAAGACTGGGAAGGATGTAGACGGCGCGGCATGGGTCAATTTGTGGGGAGGCATTGC
GTGCGTGCACACCGGTGTCAAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail