Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102670
Gene name
Locationscaffold_7:1412779..1414963
Strand-
Gene length (bp)2184
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03949 Malic_M Malic enzyme, NAD binding domain 3.6E-92 237 494
PF00390 malic Malic enzyme, N-terminal domain 4.8E-62 49 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6TU48|MAOX_DICDI NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1 20 529 7.0E-155
sp|P27443|MAOM_ASCSU NAD-dependent malic enzyme, mitochondrial (Fragment) OS=Ascaris suum PE=1 SV=1 9 498 5.0E-135
sp|Q9XGZ0|MAOP3_ARATH NADP-dependent malic enzyme 3 OS=Arabidopsis thaliana GN=NADP-ME3 PE=1 SV=1 13 490 1.0E-133
sp|P37223|MAOX_MESCR NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1 9 499 3.0E-133
sp|P51615|MAOX_VITVI NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1 13 499 5.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6TU48|MAOX_DICDI NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1 20 529 7.0E-155
sp|P27443|MAOM_ASCSU NAD-dependent malic enzyme, mitochondrial (Fragment) OS=Ascaris suum PE=1 SV=1 9 498 5.0E-135
sp|Q9XGZ0|MAOP3_ARATH NADP-dependent malic enzyme 3 OS=Arabidopsis thaliana GN=NADP-ME3 PE=1 SV=1 13 490 1.0E-133
sp|P37223|MAOX_MESCR NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1 9 499 3.0E-133
sp|P51615|MAOX_VITVI NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1 13 499 5.0E-133
sp|P43279|MAOC_ORYSJ NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2 13 499 4.0E-132
sp|O82191|MAOP1_ARATH NADP-dependent malic enzyme 1 OS=Arabidopsis thaliana GN=NADP-ME1 PE=1 SV=1 9 501 1.0E-130
sp|P16243|MAOC_MAIZE NADP-dependent malic enzyme, chloroplastic OS=Zea mays GN=MOD1 PE=1 SV=1 9 499 2.0E-130
sp|P36444|MAOC_FLAPR NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1 13 499 1.0E-129
sp|P13697|MAOX_RAT NADP-dependent malic enzyme OS=Rattus norvegicus GN=Me1 PE=1 SV=2 34 497 1.0E-129
sp|Q6FFL8|MAO1_ACIAD NAD-dependent malic enzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=maeA PE=3 SV=1 14 527 2.0E-129
sp|P22178|MAOC_FLATR NADP-dependent malic enzyme, chloroplastic OS=Flaveria trinervia GN=MOD1 PE=2 SV=1 13 499 2.0E-129
sp|P12628|MAOX_PHAVU NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1 9 499 2.0E-129
sp|P34105|MAOX_POPTR NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3 9 499 2.0E-128
sp|Q9LYG3|MAOP2_ARATH NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana GN=NADP-ME2 PE=1 SV=1 13 502 2.0E-128
sp|Q99KE1|MAOM_MOUSE NAD-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me2 PE=1 SV=1 29 490 6.0E-128
sp|Q9CA83|MAOP4_ARATH NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana GN=NADP-ME4 PE=1 SV=1 9 499 6.0E-128
sp|P06801|MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus GN=Me1 PE=1 SV=2 34 497 4.0E-126
sp|P23368|MAOM_HUMAN NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME2 PE=1 SV=1 28 490 6.0E-126
sp|Q8L7K9|MAO2_ARATH NAD-dependent malic enzyme 2, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME2 PE=1 SV=1 31 525 2.0E-125
sp|Q5QWY8|MAO1_IDILO NAD-dependent malic enzyme OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=maeA PE=3 SV=1 9 527 4.0E-125
sp|C5BCM3|MAO1_EDWI9 NAD-dependent malic enzyme OS=Edwardsiella ictaluri (strain 93-146) GN=maeA PE=3 SV=1 23 527 5.0E-125
sp|P37222|MAOC_SOLLC NADP-dependent malic enzyme, chloroplastic (Fragment) OS=Solanum lycopersicum PE=2 SV=1 13 493 1.0E-123
sp|Q8BMF3|MAON_MOUSE NADP-dependent malic enzyme, mitochondrial OS=Mus musculus GN=Me3 PE=1 SV=2 13 496 2.0E-123
sp|B2VIF2|MAO1_ERWT9 NAD-dependent malic enzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=maeA PE=3 SV=1 20 531 3.0E-123
sp|Q2NUD3|MAO1_SODGM NAD-dependent malic enzyme OS=Sodalis glossinidius (strain morsitans) GN=maeA PE=3 SV=1 20 527 6.0E-123
sp|P48163|MAOX_HUMAN NADP-dependent malic enzyme OS=Homo sapiens GN=ME1 PE=1 SV=1 13 497 1.0E-122
sp|Q29558|MAOX_PIG NADP-dependent malic enzyme (Fragment) OS=Sus scrofa GN=ME1 PE=2 SV=1 13 497 3.0E-122
sp|Q16798|MAON_HUMAN NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME3 PE=2 SV=2 13 496 1.0E-121
sp|P37225|MAON_SOLTU NAD-dependent malic enzyme 59 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 33 525 2.0E-121
sp|A7MN74|MAO1_CROS8 NAD-dependent malic enzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=maeA PE=3 SV=2 20 531 2.0E-121
sp|P28227|MAOX_ANAPL NADP-dependent malic enzyme OS=Anas platyrhynchos GN=ME1 PE=1 SV=1 13 497 2.0E-121
sp|P40927|MAOX_COLLI NADP-dependent malic enzyme OS=Columba livia GN=ME1 PE=1 SV=1 13 497 5.0E-121
sp|Q7N6K4|MAO1_PHOLL NAD-dependent malic enzyme OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=maeA PE=3 SV=1 37 527 5.0E-121
sp|A4WAJ3|MAO1_ENT38 NAD-dependent malic enzyme OS=Enterobacter sp. (strain 638) GN=maeA PE=3 SV=1 20 531 2.0E-120
sp|A1JTY5|MAO1_YERE8 NAD-dependent malic enzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=maeA PE=3 SV=1 20 527 2.0E-120
sp|A6T9K7|MAO1_KLEP7 NAD-dependent malic enzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=maeA PE=3 SV=1 20 531 2.0E-120
sp|A9L2F4|MAO1_SHEB9 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS195) GN=maeA PE=3 SV=1 14 528 3.0E-120
sp|A3D0E1|MAO1_SHEB5 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=maeA PE=3 SV=1 14 528 3.0E-120
sp|A7N025|MAO1_VIBCB NAD-dependent malic enzyme OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=maeA PE=3 SV=1 23 528 3.0E-120
sp|Q47WB0|MAO1_COLP3 NAD-dependent malic enzyme OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=maeA PE=3 SV=1 4 528 4.0E-120
sp|C6DDS6|MAO1_PECCP NAD-dependent malic enzyme OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=maeA PE=3 SV=1 20 527 4.0E-120
sp|Q87Q92|MAO1_VIBPA NAD-dependent malic enzyme OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=maeA PE=3 SV=1 23 528 4.0E-120
sp|O34389|MAO3_BACSU Probable NAD-dependent malic enzyme 3 OS=Bacillus subtilis (strain 168) GN=malS PE=3 SV=1 13 499 6.0E-120
sp|B5XX25|MAO1_KLEP3 NAD-dependent malic enzyme OS=Klebsiella pneumoniae (strain 342) GN=maeA PE=3 SV=1 20 531 1.0E-119
sp|A6WSH0|MAO1_SHEB8 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS185) GN=maeA PE=3 SV=1 14 528 1.0E-119
sp|B8E835|MAO1_SHEB2 NAD-dependent malic enzyme OS=Shewanella baltica (strain OS223) GN=maeA PE=3 SV=1 14 528 1.0E-119
sp|Q0HYM7|MAO1_SHESR NAD-dependent malic enzyme OS=Shewanella sp. (strain MR-7) GN=maeA PE=3 SV=1 14 528 1.0E-119
sp|Q0HFA9|MAO1_SHESM NAD-dependent malic enzyme OS=Shewanella sp. (strain MR-4) GN=maeA PE=3 SV=1 14 528 1.0E-119
sp|Q9SIU0|MAO1_ARATH NAD-dependent malic enzyme 1, mitochondrial OS=Arabidopsis thaliana GN=NAD-ME1 PE=1 SV=1 31 524 1.0E-119
sp|A1RNF8|MAO1_SHESW NAD-dependent malic enzyme OS=Shewanella sp. (strain W3-18-1) GN=maeA PE=3 SV=1 14 528 2.0E-119
sp|A4Y3I1|MAO1_SHEPC NAD-dependent malic enzyme OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=maeA PE=3 SV=1 14 528 2.0E-119
sp|B4ESY2|MAO1_PROMH NAD-dependent malic enzyme OS=Proteus mirabilis (strain HI4320) GN=maeA PE=3 SV=1 37 527 2.0E-119
sp|B5FEY5|MAO1_VIBFM NAD-dependent malic enzyme OS=Vibrio fischeri (strain MJ11) GN=maeA PE=3 SV=1 24 528 2.0E-119
sp|A0KT69|MAO1_SHESA NAD-dependent malic enzyme OS=Shewanella sp. (strain ANA-3) GN=maeA PE=3 SV=1 14 528 3.0E-119
sp|Q8D911|MAO1_VIBVU NAD-dependent malic enzyme OS=Vibrio vulnificus (strain CMCP6) GN=maeA PE=3 SV=1 23 528 4.0E-119
sp|Q7MLG3|MAO11_VIBVY NAD-dependent malic enzyme 1 OS=Vibrio vulnificus (strain YJ016) GN=maeA1 PE=3 SV=2 23 528 4.0E-119
sp|Q12RA0|MAO1_SHEDO NAD-dependent malic enzyme OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=maeA PE=3 SV=1 14 528 4.0E-119
sp|Q6D3B3|MAO1_PECAS NAD-dependent malic enzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=maeA PE=3 SV=1 20 527 8.0E-119
sp|A8AGN6|MAO1_CITK8 NAD-dependent malic enzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=maeA PE=3 SV=1 20 499 9.0E-119
sp|A9MR05|MAO1_SALAR NAD-dependent malic enzyme OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=maeA PE=3 SV=1 20 527 1.0E-118
sp|Q8EAP2|MAO1_SHEON NAD-dependent malic enzyme OS=Shewanella oneidensis (strain MR-1) GN=maeA PE=3 SV=1 14 528 1.0E-118
sp|Q9KSR8|MAO1_VIBCH NAD-dependent malic enzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=maeA PE=3 SV=2 24 528 2.0E-118
sp|A5F1Z0|MAO1_VIBC3 NAD-dependent malic enzyme OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=maeA PE=3 SV=2 24 528 2.0E-118
sp|B1JPZ6|MAO1_YERPY NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|Q66C80|MAO1_YERPS NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|A4TKN8|MAO1_YERPP NAD-dependent malic enzyme OS=Yersinia pestis (strain Pestoides F) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|Q1CGT4|MAO1_YERPN NAD-dependent malic enzyme OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|Q8ZG09|MAO1_YERPE NAD-dependent malic enzyme OS=Yersinia pestis GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|B2JZJ5|MAO1_YERPB NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|Q1C9U8|MAO1_YERPA NAD-dependent malic enzyme OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|A7FJK4|MAO1_YERP3 NAD-dependent malic enzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=maeA PE=3 SV=1 20 527 4.0E-118
sp|B6EK11|MAO1_ALISL NAD-dependent malic enzyme OS=Aliivibrio salmonicida (strain LFI1238) GN=maeA PE=3 SV=1 24 528 7.0E-118
sp|Q5E4J3|MAO1_VIBF1 NAD-dependent malic enzyme OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=maeA PE=3 SV=1 24 528 1.0E-117
sp|B7L7H9|MAO1_ECO55 NAD-dependent malic enzyme OS=Escherichia coli (strain 55989 / EAEC) GN=maeA PE=3 SV=1 20 499 1.0E-117
sp|A7ZLS1|MAO1_ECO24 NAD-dependent malic enzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=maeA PE=3 SV=1 20 499 1.0E-117
sp|A1S8W7|MAO1_SHEAM NAD-dependent malic enzyme OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=maeA PE=3 SV=1 14 528 2.0E-117
sp|Q8ZPE8|MAO1_SALTY NAD-dependent malic enzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|Q8Z728|MAO1_SALTI NAD-dependent malic enzyme OS=Salmonella typhi GN=maeA PE=3 SV=2 20 527 3.0E-117
sp|B4TW15|MAO1_SALSV NAD-dependent malic enzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|A9MYU8|MAO1_SALPB NAD-dependent malic enzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|Q5PHY7|MAO1_SALPA NAD-dependent malic enzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=maeA PE=3 SV=2 20 527 3.0E-117
sp|B4TII8|MAO1_SALHS NAD-dependent malic enzyme OS=Salmonella heidelberg (strain SL476) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|P45868|MAO2_BACSU Probable NAD-dependent malic enzyme 2 OS=Bacillus subtilis (strain 168) GN=maeA PE=1 SV=1 13 499 3.0E-117
sp|Q83ML6|MAO1_SHIFL NAD-dependent malic enzyme OS=Shigella flexneri GN=maeA PE=3 SV=4 20 499 3.0E-117
sp|Q0T457|MAO1_SHIF8 NAD-dependent malic enzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7LQX1|MAO1_ESCF3 NAD-dependent malic enzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7N4P2|MAO1_ECOLU NAD-dependent malic enzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|P26616|MAO1_ECOLI NAD-dependent malic enzyme OS=Escherichia coli (strain K12) GN=maeA PE=1 SV=4 20 499 3.0E-117
sp|B1XE70|MAO1_ECODH NAD-dependent malic enzyme OS=Escherichia coli (strain K12 / DH10B) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|C4ZWP8|MAO1_ECOBW NAD-dependent malic enzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7LZ73|MAO1_ECO8A NAD-dependent malic enzyme OS=Escherichia coli O8 (strain IAI1) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7MUR3|MAO1_ECO81 NAD-dependent malic enzyme OS=Escherichia coli O81 (strain ED1a) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|Q1RBT9|MAO1_ECOUT NAD-dependent malic enzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=maeA PE=3 SV=2 20 499 3.0E-117
sp|Q0THU1|MAO1_ECOL5 NAD-dependent malic enzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|A1AB75|MAO1_ECOK1 NAD-dependent malic enzyme OS=Escherichia coli O1:K1 / APEC GN=maeA PE=3 SV=2 20 499 3.0E-117
sp|B7NHU3|MAO1_ECO7I NAD-dependent malic enzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7MMW1|MAO1_ECO45 NAD-dependent malic enzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B7URL9|MAO1_ECO27 NAD-dependent malic enzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|B5QTN6|MAO1_SALEP NAD-dependent malic enzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|B5FHJ6|MAO1_SALDC NAD-dependent malic enzyme OS=Salmonella dublin (strain CT_02021853) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|B4T5V6|MAO1_SALNS NAD-dependent malic enzyme OS=Salmonella newport (strain SL254) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|Q3Z1M2|MAO1_SHISS NAD-dependent malic enzyme OS=Shigella sonnei (strain Ss046) GN=maeA PE=3 SV=2 20 499 3.0E-117
sp|B5RAB4|MAO1_SALG2 NAD-dependent malic enzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=maeA PE=3 SV=1 20 527 3.0E-117
sp|B1LFD8|MAO1_ECOSM NAD-dependent malic enzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=maeA PE=3 SV=1 20 499 3.0E-117
sp|Q6LQM6|MAO11_PHOPR NAD-dependent malic enzyme 1 OS=Photobacterium profundum GN=maeA1 PE=3 SV=2 20 522 4.0E-117
sp|A0KHR8|MAO1_AERHH NAD-dependent malic enzyme OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=maeA PE=3 SV=2 20 528 4.0E-117
sp|B5F5W5|MAO1_SALA4 NAD-dependent malic enzyme OS=Salmonella agona (strain SL483) GN=maeA PE=3 SV=1 20 527 4.0E-117
sp|Q57P88|MAO1_SALCH NAD-dependent malic enzyme OS=Salmonella choleraesuis (strain SC-B67) GN=maeA PE=3 SV=2 20 527 5.0E-117
sp|Q8FHH1|MAO1_ECOL6 NAD-dependent malic enzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=maeA PE=3 SV=2 20 499 5.0E-117
sp|B1IRX9|MAO1_ECOLC NAD-dependent malic enzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=maeA PE=3 SV=1 20 499 6.0E-117
sp|A8A036|MAO1_ECOHS NAD-dependent malic enzyme OS=Escherichia coli O9:H4 (strain HS) GN=maeA PE=3 SV=1 20 499 6.0E-117
sp|Q320R8|MAO1_SHIBS NAD-dependent malic enzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=maeA PE=3 SV=2 20 499 6.0E-117
sp|B2U1M1|MAO1_SHIB3 NAD-dependent malic enzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=maeA PE=3 SV=1 20 499 6.0E-117
sp|Q6MJE4|MAO1_BDEBA NAD-dependent malic enzyme OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=maeA PE=3 SV=1 20 527 1.0E-116
sp|B5Z1T9|MAO1_ECO5E NAD-dependent malic enzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=maeA PE=3 SV=1 20 499 1.0E-116
sp|Q8XAS9|MAO1_ECO57 NAD-dependent malic enzyme OS=Escherichia coli O157:H7 GN=maeA PE=3 SV=2 20 499 1.0E-116
sp|A8GC31|MAO1_SERP5 NAD-dependent malic enzyme OS=Serratia proteamaculans (strain 568) GN=maeA PE=3 SV=1 20 527 2.0E-116
sp|Q4ZW63|MAO1_PSEU2 NAD-dependent malic enzyme OS=Pseudomonas syringae pv. syringae (strain B728a) GN=maeA PE=3 SV=2 24 531 5.0E-116
sp|A4SKE9|MAO1_AERS4 NAD-dependent malic enzyme OS=Aeromonas salmonicida (strain A449) GN=maeA PE=3 SV=1 20 528 6.0E-116
sp|Q48LC8|MAO1_PSE14 NAD-dependent malic enzyme OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=maeA PE=3 SV=2 24 531 7.0E-116
sp|Q086X9|MAO1_SHEFN NAD-dependent malic enzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=maeA PE=3 SV=1 14 528 2.0E-115
sp|Q87Y79|MAO1_PSESM NAD-dependent malic enzyme OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=maeA PE=3 SV=2 24 531 2.0E-115
sp|Q6LHK5|MAO12_PHOPR NAD-dependent malic enzyme 2 OS=Photobacterium profundum GN=maeA2 PE=3 SV=1 19 524 3.0E-114
sp|B1KFN0|MAO1_SHEWM NAD-dependent malic enzyme OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=maeA PE=3 SV=1 14 528 3.0E-114
sp|A8H7G5|MAO1_SHEPA NAD-dependent malic enzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=maeA PE=3 SV=1 14 498 6.0E-114
sp|Q1QC40|MAO1_PSYCK NAD-dependent malic enzyme OS=Psychrobacter cryohalolentis (strain K5) GN=maeA PE=3 SV=1 14 527 6.0E-114
sp|B8CQT6|MAO1_SHEPW NAD-dependent malic enzyme OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=maeA PE=3 SV=1 14 528 2.0E-112
sp|B0TRQ2|MAO1_SHEHH NAD-dependent malic enzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=maeA PE=3 SV=1 14 498 4.0E-112
sp|Q48796|MLES_OENOE Malolactic enzyme OS=Oenococcus oeni GN=mleA PE=3 SV=1 24 483 8.0E-112
sp|A3QH80|MAO1_SHELP NAD-dependent malic enzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=maeA PE=3 SV=1 14 528 3.0E-111
sp|P37224|MAOM_AMAHP NAD-dependent malic enzyme 65 kDa isoform, mitochondrial OS=Amaranthus hypochondriacus PE=1 SV=1 13 524 4.0E-111
sp|P37221|MAOM_SOLTU NAD-dependent malic enzyme 62 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1 36 524 3.0E-110
sp|Q4FRX3|MAO1_PSYA2 NAD-dependent malic enzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=maeA PE=3 SV=1 14 524 8.0E-110
sp|A8FZ49|MAO1_SHESH NAD-dependent malic enzyme OS=Shewanella sediminis (strain HAW-EB3) GN=maeA PE=3 SV=1 14 528 1.0E-109
sp|A1SSC6|MAO1_PSYIN NAD-dependent malic enzyme OS=Psychromonas ingrahamii (strain 37) GN=maeA PE=3 SV=1 14 530 2.0E-109
sp|P9WK25|MAOX_MYCTU Putative malate oxidoreductase [NAD] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mez PE=1 SV=1 11 524 3.0E-108
sp|P9WK24|MAOX_MYCTO Putative malate oxidoreductase [NAD] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mez PE=3 SV=1 11 524 3.0E-108
sp|Q7MJC0|MAO12_VIBVY NAD-dependent malic enzyme 2 OS=Vibrio vulnificus (strain YJ016) GN=maeA2 PE=3 SV=1 34 498 1.0E-107
sp|Q02QW0|MAO1_PSEAB NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=maeA PE=3 SV=1 20 527 1.0E-105
sp|P36013|MAOM_YEAST NAD-dependent malic enzyme, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAE1 PE=1 SV=1 13 527 1.0E-105
sp|Q9HYD5|MAO1_PSEAE NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=maeA PE=3 SV=1 20 527 2.0E-105
sp|B7UWK9|MAO1_PSEA8 NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=maeA PE=3 SV=1 20 527 6.0E-105
sp|P78715|MAOH_NEOFR Malic enzyme, hydrogenosomal OS=Neocallimastix frontalis PE=1 SV=1 23 496 6.0E-104
sp|A6V1V5|MAO1_PSEA7 NAD-dependent malic enzyme OS=Pseudomonas aeruginosa (strain PA7) GN=maeA PE=3 SV=1 20 527 5.0E-101
sp|P40375|MAOX_SCHPO NAD-dependent malic enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae2 PE=1 SV=1 7 524 1.0E-100
sp|Q48662|MLES_LACLA Malolactic enzyme OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mleS PE=3 SV=2 8 499 2.0E-98
sp|P16468|MAOX_GEOSE NAD-dependent malic enzyme OS=Geobacillus stearothermophilus PE=1 SV=1 68 499 3.0E-22
sp|O34962|MAO4_BACSU Probable NAD-dependent malic enzyme 4 OS=Bacillus subtilis (strain 168) GN=ytsJ PE=3 SV=1 115 474 2.0E-16
sp|P76558|MAO2_ECOLI NADP-dependent malic enzyme OS=Escherichia coli (strain K12) GN=maeB PE=1 SV=1 101 499 3.0E-11
sp|Q9ZFV8|MAO2_SALTY NADP-dependent malic enzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=maeB PE=3 SV=2 115 499 6.0E-11
sp|P54572|MAO1_BACSU Probable NAD-dependent malic enzyme 1 OS=Bacillus subtilis (strain 168) GN=yqkJ PE=3 SV=1 68 379 1.0E-10
sp|Q9ZDF6|MAO2_RICPR Probable NADP-dependent malic enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP373 PE=3 SV=1 115 450 6.0E-09
sp|P43837|MAO2_HAEIN NADP-dependent malic enzyme OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=maeB PE=3 SV=1 115 499 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0004471 malate dehydrogenase (decarboxylating) (NAD+) activity Yes
GO:0000166 nucleotide binding No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0016615 malate dehydrogenase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0004470 malic enzyme activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102670
MAPGTASLALRTPPYFCQTDHRQRCLAQLRSKVSGLEKYIYLNGLKERDFIIFYELVLANVLELIPILYTPTVGD
ACSNYSHIWRHSEGLYISIEHKGHIRDVLRAWPSGQHARIAVVTDGSRILGLGDLGANGLPIAIGKLDLYIVGAG
VRPSTTVPICLDLGTNTQKFIDDPLYLGLRRKRPDTEEMDAFMQEFIDSMKEIFPHLLVQFEDFSTDNAFRYLDL
FRTKYCVFNDDIQGTGAVVLSGFINAAKLSSQAAGTPLHDQRILFFGAGSAGIGVAKQLMSFFTVLGLSEEEAKN
RIYTVDSKGLITTDRKGLQAHKTYFARTDYTGAPLTSLIDIIRFVKPTALLGLSTIRNAFTEEVVKLMAEMNKRP
IIFPLSNPVALCEIDYADAVQWTNGSVIFASGSPYKSVEFKGKTYEPGQGNNMYIFPGLGLGTILSKAKHVTDSM
VERASIALSDSLTREEKEAQLVYPRLGRIRDISVEIAFAVIRAAQKDGVDGNTLFRNLSDDVLFDTIKSKQWMPT
DRRSSVL*
Coding >AgabiH97|102670
ATGGCTCCTGGTACTGCCTCTCTTGCTCTCCGCACTCCTCCCTATTTCTGCCAAACTGATCATCGTCAGCGTTGC
CTTGCTCAGCTTCGGAGCAAGGTGTCTGGACTTGAGAAATATATCTACCTCAACGGTCTCAAGGAACGCGACTTT
ATTATCTTCTATGAACTTGTCCTCGCCAATGTCCTGGAACTGATTCCCATTCTCTATACCCCTACCGTTGGCGAC
GCGTGCTCCAATTATTCACACATTTGGAGGCACTCCGAAGGTCTCTATATATCCATTGAGCATAAAGGCCATATC
AGAGATGTCCTTCGTGCATGGCCCTCAGGCCAACATGCTAGGATTGCTGTTGTCACTGATGGCTCCCGTATTCTC
GGGTTAGGTGACCTTGGTGCAAACGGCCTGCCTATAGCCATTGGCAAATTAGATTTGTATATCGTTGGTGCTGGC
GTCAGACCATCTACTACCGTCCCTATTTGTCTCGACCTGGGTACCAATACTCAGAAATTTATTGATGATCCCCTC
TATTTGGGACTGCGCCGTAAACGTCCTGACACCGAAGAGATGGACGCCTTTATGCAAGAGTTCATTGACTCGATG
AAGGAGATTTTCCCGCACCTCCTCGTCCAATTTGAAGACTTTTCAACCGATAATGCGTTCAGGTACCTGGACCTG
TTTAGGACCAAGTACTGCGTCTTTAATGATGATATACAAGGCACTGGCGCTGTTGTTTTATCTGGATTCATAAAT
GCTGCGAAACTATCTTCACAGGCTGCTGGCACACCTTTACACGATCAGCGTATCCTGTTCTTTGGAGCTGGTTCC
GCTGGTATTGGTGTTGCCAAACAGCTTATGTCCTTTTTCACCGTGCTCGGTTTGAGTGAAGAGGAGGCCAAGAAT
CGAATCTATACCGTGGATTCTAAGGGCCTTATCACTACAGACAGGAAGGGCTTGCAAGCTCATAAAACTTATTTC
GCCCGTACAGACTACACTGGAGCTCCTTTGACAAGCTTGATCGACATCATCCGGTTTGTCAAACCCACCGCTTTG
CTCGGTTTAAGCACTATCCGAAACGCATTCACAGAAGAAGTCGTGAAGCTCATGGCGGAAATGAACAAGCGACCC
ATTATATTTCCCCTCTCTAATCCTGTTGCCTTATGTGAAATTGATTATGCCGACGCTGTCCAATGGACAAATGGC
TCCGTCATCTTCGCTTCTGGGAGCCCCTATAAATCCGTCGAGTTCAAGGGCAAAACATATGAACCTGGTCAAGGC
AATAACATGTATATTTTCCCTGGACTTGGATTGGGGACCATCTTGTCCAAAGCTAAGCACGTCACGGACTCCATG
GTTGAACGCGCATCCATAGCCCTTTCCGACTCATTGACGCGGGAAGAAAAGGAGGCACAGCTCGTGTATCCTCGC
CTCGGACGCATCCGTGACATCTCTGTTGAAATTGCGTTCGCTGTTATACGTGCTGCCCAGAAAGATGGTGTCGAT
GGCAACACTCTCTTCCGCAACTTATCTGACGATGTCCTCTTCGACACCATCAAATCTAAGCAATGGATGCCTACA
GACCGTCGCTCTTCCGTTTTGTAG
Transcript >AgabiH97|102670
ATGGCTCCTGGTACTGCCTCTCTTGCTCTCCGCACTCCTCCCTATTTCTGCCAAACTGATCATCGTCAGCGTTGC
CTTGCTCAGCTTCGGAGCAAGGTGTCTGGACTTGAGAAATATATCTACCTCAACGGTCTCAAGGAACGCGACTTT
ATTATCTTCTATGAACTTGTCCTCGCCAATGTCCTGGAACTGATTCCCATTCTCTATACCCCTACCGTTGGCGAC
GCGTGCTCCAATTATTCACACATTTGGAGGCACTCCGAAGGTCTCTATATATCCATTGAGCATAAAGGCCATATC
AGAGATGTCCTTCGTGCATGGCCCTCAGGCCAACATGCTAGGATTGCTGTTGTCACTGATGGCTCCCGTATTCTC
GGGTTAGGTGACCTTGGTGCAAACGGCCTGCCTATAGCCATTGGCAAATTAGATTTGTATATCGTTGGTGCTGGC
GTCAGACCATCTACTACCGTCCCTATTTGTCTCGACCTGGGTACCAATACTCAGAAATTTATTGATGATCCCCTC
TATTTGGGACTGCGCCGTAAACGTCCTGACACCGAAGAGATGGACGCCTTTATGCAAGAGTTCATTGACTCGATG
AAGGAGATTTTCCCGCACCTCCTCGTCCAATTTGAAGACTTTTCAACCGATAATGCGTTCAGGTACCTGGACCTG
TTTAGGACCAAGTACTGCGTCTTTAATGATGATATACAAGGCACTGGCGCTGTTGTTTTATCTGGATTCATAAAT
GCTGCGAAACTATCTTCACAGGCTGCTGGCACACCTTTACACGATCAGCGTATCCTGTTCTTTGGAGCTGGTTCC
GCTGGTATTGGTGTTGCCAAACAGCTTATGTCCTTTTTCACCGTGCTCGGTTTGAGTGAAGAGGAGGCCAAGAAT
CGAATCTATACCGTGGATTCTAAGGGCCTTATCACTACAGACAGGAAGGGCTTGCAAGCTCATAAAACTTATTTC
GCCCGTACAGACTACACTGGAGCTCCTTTGACAAGCTTGATCGACATCATCCGGTTTGTCAAACCCACCGCTTTG
CTCGGTTTAAGCACTATCCGAAACGCATTCACAGAAGAAGTCGTGAAGCTCATGGCGGAAATGAACAAGCGACCC
ATTATATTTCCCCTCTCTAATCCTGTTGCCTTATGTGAAATTGATTATGCCGACGCTGTCCAATGGACAAATGGC
TCCGTCATCTTCGCTTCTGGGAGCCCCTATAAATCCGTCGAGTTCAAGGGCAAAACATATGAACCTGGTCAAGGC
AATAACATGTATATTTTCCCTGGACTTGGATTGGGGACCATCTTGTCCAAAGCTAAGCACGTCACGGACTCCATG
GTTGAACGCGCATCCATAGCCCTTTCCGACTCATTGACGCGGGAAGAAAAGGAGGCACAGCTCGTGTATCCTCGC
CTCGGACGCATCCGTGACATCTCTGTTGAAATTGCGTTCGCTGTTATACGTGCTGCCCAGAAAGATGGTGTCGAT
GGCAACACTCTCTTCCGCAACTTATCTGACGATGTCCTCTTCGACACCATCAAATCTAAGCAATGGATGCCTACA
GACCGTCGCTCTTCCGTTTTGTAG
Gene >AgabiH97|102670
ATGGCTCCTGGTACTGCCTCTCTTGCTCTCCGCACTCCTCCCTATTTCTGCCAAACTGATCATCGTCAGCGTTGC
CTTGCTCAGCTTCGGAGCAAGGTGTCTGGACTTGAGAAATATATCTACCTCAACGGTCTCAAGGAACGCGACTTT
ATTATCTTCTATGAACTTGTCCTCGCCAATGTCCTGGAACTGATTCCCATTCTCTATACCCCTACCGTTCGTTTC
ATTATTTATTTTAGTTTTTTGATAAAAATAATCAGCTCACATTCGCTTCATAGGTTGGCGACGCGTGCTCCAATT
ATTCACACATTTGGAGGCACTCCGAAGGTCTCTATATATCCATTGAGCATAAAGGCCATATCAGAGATGTCCTTC
GTGCATGGCCCTCAGGCCAACATGCTAGGATTGCTGTTGTCACTGATGGTCGGTGTCGTTTGAGTGTACCGACTG
TGGCTGACTGACATTTATAATCCAGGCTCCCGTATTCTCGGGTTAGGTGACCTTGGTGCAAACGGCCTGCCTATA
GCCATTGGCAAATTGCAAGTTATATTCTCTGGAATAGCGTTTTATTTACTGAATGACTCGATTTTCTAGAGATTT
GTATATCGTTGGTGCTGGCGTCAGACCATCTACTACCGTCCCTATTTGTCTCGACCTGGGTACCAATACTCAGAA
ATTTATTGATGATCCCCTCTATTTGGGACTGCGCCGTAAACGTCCTGACACCGAAGAGGTGATAAAGCATTGTTT
CAGTATTTTTCCGAATTCTAACAGATCCGTAGATGGACGCCTTTATGCAAGAGTTCATTGACTCGATGAAGGAGA
TTTTCCCGCACCTCCTCGTCCAATTTGAAGACTTTTCAACCGATAATGCGTTCAGGTACCTGGACCTGTTTAGGA
CCAAGTACTGCGTCTTTAATGATGATGTAGGTCCATAGCCACTGTGTTGGTTCTGATCTTATCCATTAACTCTTT
TACTTGTACAGATACAAGGCACTGGTATGGACTTTGGATTTCATTAATGAGTTGGTTTCGCTAATAGCTTTCTAG
GCGCTGTTGTTTTATCTGGATTCATAAATGCTGCGAAACTATCTTCACAGGCTGCTGGCACACCTTTACACGATC
AGCGTATCCTGTTCTTTGGAGCTGGTTCCGCTGGTATTGGTGTTGCCAAACAGCTTATGTCCTTTTTCACCGTGC
TCGGTTTGAGTGAAGAGGAGGCCAAGAATCGAATCTATGTTTGTGTTTTCCAATCTGTCGTTTCATTATGGAGTT
AACTGTTTGTTCCAGACCGTGGATTCTAAGGGCCTTATCACTACAGACAGGAAGGGCTTGCAAGCTCATAAAACT
TGTTTGTTTTCCCTGCAAGTTCTATATGATCATCTACTGAATAATGTAAACAGATTTCGCCCGTACAGACTACAC
TGGAGCTCCTTTGACAAGCTTGATCGACATCATCCGGTTTGTCAAACCCACCGCTTTGCTCGGTTTAAGCACTAT
CCGAGTAGGTTACTTTACTATCACTCATCAGTACGAGAAGTTGACCATTGAATAGAACGCATTCACAGAAGAAGT
CGTGAAGCTCATGGCGGAAATGAACAAGCGACCCATTATATTTCCCCTCTCTAATCCTGTTGCCTTATGTGAAAT
TGATTATGCCGACGCTGTCCAATGGTATATTTATTCTCTACTGACGGTATACAATATTCTTACCCCAAAATTCAG
GACAAATGGCTCCGTCATCTTCGCTTCTGGGAGCCCCTATAAATCCGTCGAGTTCAAGGGCAAAACATATGAACC
TGGTCAAGGCAATAACATGTATATTTTCCCTGGACTTGGATTGGGGACCATCTTGTCCAAAGCTAAGCACGTCAC
GGACTCCATGGTTGAACGCGCATCCATAGCCCTTTCCGACTCATTGACGCGGGAAGAAAAGGAGGCACAGCTCGT
GTATCCTCGCCTCGGACGCATCCGTGACATCTCTGTTGAAATTGCGTTCGCTGTTATACGTGCTGCCCAGAAAGA
TGTGAGCGTTTGTTTAATATTGACGATCTTCACGCTCATGTAGATAATTAGGGTGTCGATGGCAACACTCTCTTC
CGCAACTTATCTGACGATGTCCTCTTCGACACCATCAAATCTAAGCAATGGATGCCTACAGACCGTCGCTCTTCC
GTTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail