Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102590
Gene name
Locationscaffold_7:1387979..1389661
Strand+
Gene length (bp)1682
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13679 Methyltransf_32 Methyltransferase domain 5.3E-23 112 276

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5E9V4|RRNAD_BOVIN Protein RRNAD1 OS=Bos taurus GN=RRNAD1 PE=2 SV=1 111 345 2.0E-10
sp|Q96FB5|RRNAD_HUMAN Protein RRNAD1 OS=Homo sapiens GN=RRNAD1 PE=2 SV=2 111 345 3.0E-10
sp|Q6AYG0|RRNAD_RAT Protein RRNAD1 OS=Rattus norvegicus GN=Rrnad1 PE=2 SV=1 109 461 5.0E-10
sp|Q8BZG5|RRNAD_MOUSE Protein RRNAD1 OS=Mus musculus GN=Rrnad1 PE=2 SV=1 109 461 6.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 19.83 10.80 28.85
Initials Initials knots 30.82 17.86 43.77
Pileal_Stipeal_center Stage I stipe center 14.59 7.73 21.45
Pileal_Stipeal_shell Stage I stipe shell 10.85 5.58 16.12
DIF_stipe_center Stage II stipe center 15.52 8.35 22.69
DIF_stipe_shell Stage II stipe shell 18.72 10.29 27.14
DIF_stipe_skin Stage II stipe skin 20.51 11.35 29.67
DIF_cap_skin Stage II cap skin 14.11 7.48 20.74
DIF_cap_tissue Stage II cap tissue 11.73 6.05 17.40
DIF_gill_tissue Stage II gill tissue 10.95 5.58 16.32
YFB_stipe_center Young fruiting body stipe center 17.75 9.73 25.77
YFB_stipe_shell Young fruiting body stipe shell 19.66 10.90 28.42
YFB_stipe_skin Young fruiting body stipe skin 20.24 11.23 29.25
YFB_cap_skin Young fruiting body cap skin 14.17 7.52 20.83
YFB_cap_tissue Young fruiting body cap tissue 16.37 8.82 23.92
YFB_gill_tissue Young fruiting body gill tissue 14.38 7.61 21.14
YFB_veil Young fruiting body veil 10.75 5.43 16.06

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.056561 no
Casing YFB_stipe_center 0.835476 no
Casing YFB_stipe_shell 0.988436 no
Casing YFB_stipe_skin 0.973480 no
Casing YFB_cap_skin 0.364831 no
Casing YFB_cap_tissue 0.666185 no
Casing YFB_gill_tissue 0.397831 no
Casing YFB_veil 0.043772 yes
Casing Initials 0.152605 no
Casing Pileal_Stipeal_center 0.424877 no
Casing Pileal_Stipeal_shell 0.055979 no
Casing DIF_stipe_center 0.544115 no
Casing DIF_stipe_shell 0.919278 no
Casing DIF_stipe_skin 0.955405 no
Casing DIF_cap_skin 0.362965 no
Casing DIF_cap_tissue 0.110231 no
DIF_gill_tissue YFB_stipe_center 0.152465 no
DIF_gill_tissue YFB_stipe_shell 0.064520 no
DIF_gill_tissue YFB_stipe_skin 0.047584 yes
DIF_gill_tissue YFB_cap_skin 0.544343 no
DIF_gill_tissue YFB_cap_tissue 0.257879 no
DIF_gill_tissue YFB_gill_tissue 0.517682 no
DIF_gill_tissue YFB_veil 0.977107 no
YFB_stipe_center YFB_stipe_shell 0.848035 no
YFB_stipe_center YFB_stipe_skin 0.797410 no
YFB_stipe_center YFB_cap_skin 0.607325 no
YFB_stipe_center YFB_cap_tissue 0.887345 no
YFB_stipe_center YFB_gill_tissue 0.640499 no
YFB_stipe_center YFB_veil 0.123358 no
YFB_stipe_shell YFB_stipe_skin 0.961312 no
YFB_stipe_shell YFB_cap_skin 0.375110 no
YFB_stipe_shell YFB_cap_tissue 0.682076 no
YFB_stipe_shell YFB_gill_tissue 0.409844 no
YFB_stipe_shell YFB_veil 0.045911 yes
YFB_stipe_skin YFB_cap_skin 0.321437 no
YFB_stipe_skin YFB_cap_tissue 0.619199 no
YFB_stipe_skin YFB_gill_tissue 0.355880 no
YFB_stipe_skin YFB_veil 0.037140 yes
YFB_cap_skin YFB_cap_tissue 0.775117 no
YFB_cap_skin YFB_gill_tissue 0.982035 no
YFB_cap_skin YFB_veil 0.512152 no
YFB_cap_tissue YFB_gill_tissue 0.806492 no
YFB_cap_tissue YFB_veil 0.233642 no
YFB_gill_tissue YFB_veil 0.483060 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.057350 no
Initials YFB_stipe_shell 0.137864 no
Initials YFB_stipe_skin 0.174105 no
Initials YFB_cap_skin 0.004160 yes
Initials YFB_cap_tissue 0.025711 yes
Initials YFB_gill_tissue 0.009123 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.006742 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.011968 yes
Initials DIF_stipe_shell 0.088613 no
Initials DIF_stipe_skin 0.190009 no
Initials DIF_cap_skin 0.007092 yes
Initials DIF_cap_tissue 0.001140 yes
Pileal_Stipeal_center DIF_gill_tissue 0.491931 no
Pileal_Stipeal_center YFB_stipe_center 0.674980 no
Pileal_Stipeal_center YFB_stipe_shell 0.439686 no
Pileal_Stipeal_center YFB_stipe_skin 0.378639 no
Pileal_Stipeal_center YFB_cap_skin 0.964290 no
Pileal_Stipeal_center YFB_cap_tissue 0.833661 no
Pileal_Stipeal_center YFB_gill_tissue 0.981877 no
Pileal_Stipeal_center YFB_veil 0.448116 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.475436 no
Pileal_Stipeal_center DIF_stipe_center 0.919172 no
Pileal_Stipeal_center DIF_stipe_shell 0.546630 no
Pileal_Stipeal_center DIF_stipe_skin 0.352521 no
Pileal_Stipeal_center DIF_cap_skin 0.959769 no
Pileal_Stipeal_center DIF_cap_tissue 0.642618 no
Pileal_Stipeal_shell DIF_gill_tissue 0.988742 no
Pileal_Stipeal_shell YFB_stipe_center 0.145002 no
Pileal_Stipeal_shell YFB_stipe_shell 0.057350 no
Pileal_Stipeal_shell YFB_stipe_skin 0.043772 yes
Pileal_Stipeal_shell YFB_cap_skin 0.536319 no
Pileal_Stipeal_shell YFB_cap_tissue 0.246828 no
Pileal_Stipeal_shell YFB_gill_tissue 0.510081 no
Pileal_Stipeal_shell YFB_veil 0.988157 no
Pileal_Stipeal_shell DIF_stipe_center 0.346435 no
Pileal_Stipeal_shell DIF_stipe_shell 0.089805 no
Pileal_Stipeal_shell DIF_stipe_skin 0.037818 yes
Pileal_Stipeal_shell DIF_cap_skin 0.551896 no
Pileal_Stipeal_shell DIF_cap_tissue 0.900370 no
DIF_stipe_center DIF_gill_tissue 0.357287 no
DIF_stipe_center YFB_stipe_center 0.793081 no
DIF_stipe_center YFB_stipe_shell 0.567100 no
DIF_stipe_center YFB_stipe_skin 0.501704 no
DIF_stipe_center YFB_cap_skin 0.874104 no
DIF_stipe_center YFB_cap_tissue 0.929931 no
DIF_stipe_center YFB_gill_tissue 0.899518 no
DIF_stipe_center YFB_veil 0.315050 no
DIF_stipe_center DIF_stipe_shell 0.676195 no
DIF_stipe_center DIF_stipe_skin 0.470794 no
DIF_stipe_center DIF_cap_skin 0.866722 no
DIF_stipe_center DIF_cap_tissue 0.500293 no
DIF_stipe_shell DIF_gill_tissue 0.094492 no
DIF_stipe_shell YFB_stipe_center 0.927927 no
DIF_stipe_shell YFB_stipe_shell 0.932173 no
DIF_stipe_shell YFB_stipe_skin 0.885942 no
DIF_stipe_shell YFB_cap_skin 0.480199 no
DIF_stipe_shell YFB_cap_tissue 0.784699 no
DIF_stipe_shell YFB_gill_tissue 0.512973 no
DIF_stipe_shell YFB_veil 0.075908 no
DIF_stipe_shell DIF_stipe_skin 0.862933 no
DIF_stipe_shell DIF_cap_skin 0.476659 no
DIF_stipe_shell DIF_cap_tissue 0.169195 no
DIF_stipe_skin DIF_gill_tissue 0.041603 yes
DIF_stipe_skin YFB_stipe_center 0.766213 no
DIF_stipe_skin YFB_stipe_shell 0.942063 no
DIF_stipe_skin YFB_stipe_skin 0.983168 no
DIF_stipe_skin YFB_cap_skin 0.295910 no
DIF_stipe_skin YFB_cap_tissue 0.592355 no
DIF_stipe_skin YFB_gill_tissue 0.327027 no
DIF_stipe_skin YFB_veil 0.032978 yes
DIF_stipe_skin DIF_cap_skin 0.292037 no
DIF_stipe_skin DIF_cap_tissue 0.085898 no
DIF_cap_skin DIF_gill_tissue 0.564693 no
DIF_cap_skin YFB_stipe_center 0.603793 no
DIF_cap_skin YFB_stipe_shell 0.377028 no
DIF_cap_skin YFB_stipe_skin 0.319242 no
DIF_cap_skin YFB_cap_skin 0.993773 no
DIF_cap_skin YFB_cap_tissue 0.770809 no
DIF_cap_skin YFB_gill_tissue 0.977222 no
DIF_cap_skin YFB_veil 0.523320 no
DIF_cap_skin DIF_cap_tissue 0.709996 no
DIF_cap_tissue DIF_gill_tissue 0.912486 no
DIF_cap_tissue YFB_stipe_center 0.251537 no
DIF_cap_tissue YFB_stipe_shell 0.117324 no
DIF_cap_tissue YFB_stipe_skin 0.090496 no
DIF_cap_tissue YFB_cap_skin 0.694055 no
DIF_cap_tissue YFB_cap_tissue 0.392892 no
DIF_cap_tissue YFB_gill_tissue 0.668161 no
DIF_cap_tissue YFB_veil 0.885966 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102590
MQDTIKKLGHLHAFLISSLVQFLLRSHPNDIATNPEADIIQGCCEWFFWCRENLDGWLEIVNYYMTACDRESTLP
GDLRNILDEVRGLLLDRLPISLEGDFPQIEETGMSPKKVHEVSRMVAYILQIIRINKWDPSVLRIVDVGAGQGYL
TRSLKAQLPQTKILALDADEAQTSGAQRWERRLLPLPSNENPPITHKTIHVTPEALYSTIDTWITEESLEGIDAK
QEMLPVLLVGLHACGSLTPDVIKVLGQRSSGKTQWRIASMVVVGCCYNLMNPGDFPLSKSLKEKSPTIDLPVSAY
HLAAQVPNHWLSSLSPPTPFPSVKLALRKVIWRALLGKKLRQNAPVNHPPVEINLTPGRQLPWSRLPTAKVHNFE
LNEEGTGATPEMRRLGRLKDTAYTDWKTFVDVAEKKMGIDFGEKLKVVDRDMRMERLLECFHTLRCLVGTVVESA
IILDRLVWVDELVKSEGRSDLRTSVVNLFDQATGSGRNVAIVVAQKVPSSTEV*
Coding >AgabiH97|102590
ATGCAAGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTTATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAACCCAGAAGCAGATATTATTCAAGGCTGCTGCGAATGGTTCTTCTGGTGT
CGCGAAAATCTCGATGGTTGGCTGGAGATAGTCAATTATTACATGACAGCCTGTGATAGGGAGTCAACATTGCCG
GGCGACTTGAGAAATATTCTCGATGAGGTCAGAGGACTACTACTAGACCGACTTCCGATTTCATTGGAAGGTGAC
TTTCCGCAAATTGAAGAGACTGGAATGTCACCAAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTT
CAAATCATTCGGATTAACAAATGGGACCCATCCGTGTTACGGATTGTGGATGTTGGGGCTGGCCAAGGCTATCTA
ACGAGATCTTTGAAGGCTCAGTTACCACAAACAAAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGA
GCTCAACGTTGGGAAAGAAGATTGTTACCCCTTCCTTCGAATGAAAATCCGCCGATCACTCATAAAACTATACAC
GTTACTCCGGAAGCCCTATATTCTACTATTGATACGTGGATTACAGAAGAGAGTCTAGAAGGGATTGATGCGAAG
CAGGAGATGCTACCTGTTCTGCTCGTTGGTTTACACGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTG
GGTCAGAGGTCTTCAGGAAAGACGCAATGGAGGATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATG
AACCCGGGAGACTTCCCTCTATCTAAGTCTCTCAAAGAGAAATCTCCAACAATCGACCTTCCGGTGTCAGCTTAT
CATCTTGCGGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACACCTTTTCCTTCAGTCAAACTT
GCACTTCGTAAAGTGATTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATGCACCAGTCAATCACCCACCG
GTTGAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCGACTGCTAAAGTGCACAACTTTGAA
TTGAATGAAGAGGGCACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGAAGGATACCGCATATACCGAT
TGGAAAACATTTGTAGATGTTGCTGAAAAGAAGATGGGTATAGACTTTGGAGAGAAGCTGAAAGTTGTGGATAGG
GATATGAGGATGGAGCGCCTACTTGAATGTTTTCATACATTACGGTGTTTGGTGGGGACGGTAGTTGAGAGTGCT
ATCATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGATCGGATTTGCGGACTTCGGTC
GTGAATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAGCGCAAAAGGTACCTTCATCA
ACTGAGGTTTAA
Transcript >AgabiH97|102590
ATGCAAGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTTATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAACCCAGAAGCAGATATTATTCAAGGCTGCTGCGAATGGTTCTTCTGGTGT
CGCGAAAATCTCGATGGTTGGCTGGAGATAGTCAATTATTACATGACAGCCTGTGATAGGGAGTCAACATTGCCG
GGCGACTTGAGAAATATTCTCGATGAGGTCAGAGGACTACTACTAGACCGACTTCCGATTTCATTGGAAGGTGAC
TTTCCGCAAATTGAAGAGACTGGAATGTCACCAAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTT
CAAATCATTCGGATTAACAAATGGGACCCATCCGTGTTACGGATTGTGGATGTTGGGGCTGGCCAAGGCTATCTA
ACGAGATCTTTGAAGGCTCAGTTACCACAAACAAAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGA
GCTCAACGTTGGGAAAGAAGATTGTTACCCCTTCCTTCGAATGAAAATCCGCCGATCACTCATAAAACTATACAC
GTTACTCCGGAAGCCCTATATTCTACTATTGATACGTGGATTACAGAAGAGAGTCTAGAAGGGATTGATGCGAAG
CAGGAGATGCTACCTGTTCTGCTCGTTGGTTTACACGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTG
GGTCAGAGGTCTTCAGGAAAGACGCAATGGAGGATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATG
AACCCGGGAGACTTCCCTCTATCTAAGTCTCTCAAAGAGAAATCTCCAACAATCGACCTTCCGGTGTCAGCTTAT
CATCTTGCGGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACACCTTTTCCTTCAGTCAAACTT
GCACTTCGTAAAGTGATTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATGCACCAGTCAATCACCCACCG
GTTGAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCGACTGCTAAAGTGCACAACTTTGAA
TTGAATGAAGAGGGCACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGAAGGATACCGCATATACCGAT
TGGAAAACATTTGTAGATGTTGCTGAAAAGAAGATGGGTATAGACTTTGGAGAGAAGCTGAAAGTTGTGGATAGG
GATATGAGGATGGAGCGCCTACTTGAATGTTTTCATACATTACGGTGTTTGGTGGGGACGGTAGTTGAGAGTGCT
ATCATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGATCGGATTTGCGGACTTCGGTC
GTGAATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAGCGCAAAAGGTACCTTCATCA
ACTGAGGTTTAA
Gene >AgabiH97|102590
ATGCAAGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTTATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAACCCAGAAGCAGATATTATTCAAGGCTGCTGCGAATGGTTCTTCTGGTGT
CGCGAAAATCTCGATGGTTGGCTGGAGATAGTCAATTATTACATGACAGCCTGTGATAGGTGCGTCCTTCAAAGT
CCTTTCAAGTTCACTGTATAGAATTGTCAGGGAGTCAACATTGCCGGGCGACTTGAGAAATATTCTCGATGAGGT
CAGAGGACTACTACTAGACCGACTTCCGATTTCATTGGAAGGTGACTTTCCGCAAATTGAAGAGACTGGAATGTC
ACCAAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTTCAAATCATTCGGATTAACAAATGGGACCC
ATCCGTGTTACGGATTGTGGATGTTGGGGCTGGCCAAGTCTGTTCAAAATATTATTTTATCATTCGTGTGCTATG
GATCAGTTAACCAGAATATCTTTCGCTACCTTAGGGCTATCTAACGAGATCTTTGAAGGCTCAGTTACCACAAAC
AAAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGAGCTCAACGTTGGGAAAGAAGATTGTTACCCCT
TCCTTCGAATGAAAATCCGCCGATCACTCATAAAACTATACACGTTACTCCGGAAGCCCTATATTCTACTATTGA
TACGTGGATTACAGAAGAGAGTCTAGAAGGGATTGATGCGAAGCAGGAGATGCTACCTGTTCTGCTCGTTGGTTT
ACACGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTGGGTCAGAGGTCTTCAGGAAAGACGCAATGGAG
GATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATGAACCCGGGAGGTACGCGTTTCCTTTACGCCGC
TAAACTTGATTGACTGACGTGTGTGTCAAGACTTCCCTCTATCTAAGTCTCTCAAAGAGAAATCTCCAACAATCG
ACCTTCCGGTGTCAGCTTATCATCTTGCGGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACAC
CTTTTCCTTCAGTCAAACTTGCACTTCGTAAAGTGATTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATG
CACCAGTCAATCACCCACCGGTTGAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCGACTG
CTAAAGTGCACAACTTTGAATTGAATGAAGAGGGCACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGA
AGGATACCGCATATACCGATTGGAAAACATTTGTAGATGTTGCTGAAAAGAAGATGGGTATAGACTTTGGAGAGA
AGCTGAAAGTTGTGGATAGGGATATGAGGATGGAGCGCCTACTTGAATGTTTTCATACATTACGGTGTTTGGTGG
GGACGGTAGTTGAGAGTGCTATCATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGAT
CGGATTTGCGGACTTCGGTCGTGAATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAG
CGCAAAAGGTACCTTCATCAACTGAGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail