Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102520
Gene name
Locationscaffold_7:1365291..1367840
Strand-
Gene length (bp)2549
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09284 RhgB_N Rhamnogalacturonan lyase B, N-terminal 1.4E-103 19 263
PF14683 CBM-like Polysaccharide lyase family 4, domain III 5.8E-44 353 518
PF14686 fn3_3 Polysaccharide lyase family 4, domain II 1.1E-15 270 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CVU1|RGLA_ASPTN Probable rhamnogalacturonate lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rglA PE=3 SV=2 3 512 0.0E+00
sp|Q4W9T6|RGLA_ASPFU Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rglA PE=3 SV=1 2 519 0.0E+00
sp|B0YEH9|RGLA_ASPFC Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rglA PE=3 SV=1 2 519 0.0E+00
sp|A1D9P9|RGLA_NEOFI Probable rhamnogalacturonate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rglA PE=3 SV=1 5 519 0.0E+00
sp|A1C995|RGLA_ASPCL Probable rhamnogalacturonate lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rglA PE=3 SV=1 5 519 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CVU1|RGLA_ASPTN Probable rhamnogalacturonate lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rglA PE=3 SV=2 3 512 0.0E+00
sp|Q4W9T6|RGLA_ASPFU Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rglA PE=3 SV=1 2 519 0.0E+00
sp|B0YEH9|RGLA_ASPFC Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rglA PE=3 SV=1 2 519 0.0E+00
sp|A1D9P9|RGLA_NEOFI Probable rhamnogalacturonate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rglA PE=3 SV=1 5 519 0.0E+00
sp|A1C995|RGLA_ASPCL Probable rhamnogalacturonate lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rglA PE=3 SV=1 5 519 0.0E+00
sp|Q00019|RGLA_ASPAC Rhamnogalacturonate lyase A OS=Aspergillus aculeatus GN=rglA PE=1 SV=1 2 519 0.0E+00
sp|B8NCU7|RGLA_ASPFN Probable rhamnogalacturonate lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rglA PE=3 SV=1 5 519 0.0E+00
sp|Q2U0Q1|RGLA_ASPOR Probable rhamnogalacturonate lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rglA PE=3 SV=1 5 519 0.0E+00
sp|Q5AX45|RGLA_EMENI Rhamnogalacturonate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rglA PE=2 SV=1 9 519 9.0E-180
sp|A2R2L1|RGLA_ASPNC Probable rhamnogalacturonate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rglA PE=3 SV=2 17 512 3.0E-169
sp|P78710|ASD1_NEUCR Putative rhamnogalacturonase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-1 PE=2 SV=1 3 519 5.0E-161
sp|Q8NJK5|RGLA_ASPNG Rhamnogalacturonate lyase A (Fragment) OS=Aspergillus niger GN=rglA PE=3 SV=1 17 492 1.0E-157
sp|B8N5T6|RGLB_ASPFN Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rglB PE=3 SV=1 161 378 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030246 carbohydrate binding Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0005488 binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102520
MLLPFLNLLLWLPAALAAFGVTTSGSNMLVDSGAGLVTTIHTTNGDITSIRFNGKELQDQSKFTHLSSGLGSASV
TSSVANNIAVVTIRTNTITHYVITRSGINTIYLGTFASQEPSVGELRFIARLSKSALPRGIAEAEIEGGSAIEGS
DVFRVNGQTRSKFYSSVRFMEDQVHGVTGSGVGAFMIIPGVGYETSSGGPFFRDINNQGGAQQELYFYMNSGHEQ
TESYRTGFFGPYALAITSGSAPSGNLDTSFMDNLNLQGYVPASGRGAVSGSYSGTLSGPPVTIGFKNSNAQYWIS
GSGGGFTRNMMKPGTYTVTLYQGEFAAGTGSVSVSAGRTSSVNLSSNLSRPNTIWSIGTVDGTPAGFLNADKIEH
MHPSDSRMGNWGPTTFTIGSSSTSSFPMAQFKAVNNPTTIRWTASSSQTGARTLRIRTTESFAGGRPQVTVNSFT
SSAPPAPTKIDSRGVTRGTWRGLNEVYDFSIPSGVLVQGSNTIQINVISGSSGDSFLSPNFVFDSVELF*
Coding >AgabiH97|102520
ATGCTACTCCCCTTCTTGAATCTCTTGCTGTGGTTGCCCGCCGCTTTGGCGGCATTTGGGGTAACGACCTCCGGA
AGTAATATGCTCGTTGATTCCGGTGCTGGGCTGGTTACGACCATACACACAACAAATGGGGACATTACTTCCATT
AGGTTCAACGGAAAAGAACTGCAGGACCAATCTAAATTCACCCACCTCAGTTCAGGTCTCGGCTCAGCGTCCGTC
ACATCTTCTGTGGCAAATAACATCGCAGTGGTCACCATAAGAACAAACACCATCACCCATTATGTCATTACTCGC
TCAGGAATAAACACAATCTACTTGGGTACCTTCGCTTCTCAAGAGCCAAGTGTCGGCGAACTTCGTTTTATTGCT
CGTTTATCCAAGTCCGCGCTGCCTCGTGGTATTGCTGAAGCCGAGATTGAGGGTGGATCCGCGATTGAAGGGTCT
GATGTCTTCCGTGTCAATGGGCAGACCCGCTCCAAATTCTATTCCAGTGTCCGATTCATGGAAGATCAAGTTCAT
GGCGTAACCGGTTCTGGAGTTGGCGCGTTCATGATTATTCCTGGCGTTGGTTATGAAACATCTTCCGGTGGCCCA
TTTTTCAGAGATATCAATAATCAAGGTGGCGCTCAACAAGAGCTTTACTTCTATATGAACTCGGGCCATGAGCAA
ACAGAGTCTTATAGAACAGGCTTTTTCGGACCTTATGCTCTCGCCATTACAAGCGGTTCTGCTCCCTCTGGCAAT
CTGGATACGAGCTTCATGGACAACCTTAACCTCCAAGGCTATGTTCCAGCTTCTGGACGTGGAGCCGTTTCTGGG
AGTTACTCCGGCACTTTGTCGGGACCTCCGGTAACCATTGGCTTCAAGAATTCGAATGCGCAGTATTGGATATCT
GGTTCTGGTGGAGGGTTTACAAGAAATATGATGAAGCCCGGGACATACACCGTCACATTATATCAAGGCGAATTT
GCGGCTGGTACTGGTAGTGTATCCGTTTCAGCAGGGAGGACTTCATCTGTCAATTTGAGTTCTAATTTGTCACGC
CCGAACACAATTTGGTCAATCGGTACTGTCGATGGAACGCCCGCCGGGTTCTTGAACGCCGATAAAATCGAGCAT
ATGCACCCATCTGATTCGAGAATGGGAAATTGGGGGCCAACCACTTTCACTATAGGGTCCTCATCCACCTCATCC
TTCCCTATGGCCCAATTCAAAGCGGTGAACAACCCGACTACGATCAGGTGGACGGCTTCTTCTTCACAAACCGGT
GCACGTACTCTCCGTATCCGTACGACCGAGTCATTTGCCGGAGGCAGGCCTCAAGTCACGGTTAACTCTTTCACG
TCATCAGCTCCTCCAGCACCAACTAAAATAGACTCGCGAGGTGTTACTCGAGGTACCTGGAGAGGTCTCAACGAA
GTCTACGACTTCAGTATCCCTTCCGGTGTACTTGTCCAAGGTTCCAATACCATACAGATCAATGTCATCAGTGGT
AGCTCTGGTGACAGTTTCCTTAGTCCTAACTTCGTTTTTGATTCGGTTGAGCTATTTTAG
Transcript >AgabiH97|102520
ATGCTACTCCCCTTCTTGAATCTCTTGCTGTGGTTGCCCGCCGCTTTGGCGGCATTTGGGGTAACGACCTCCGGA
AGTAATATGCTCGTTGATTCCGGTGCTGGGCTGGTTACGACCATACACACAACAAATGGGGACATTACTTCCATT
AGGTTCAACGGAAAAGAACTGCAGGACCAATCTAAATTCACCCACCTCAGTTCAGGTCTCGGCTCAGCGTCCGTC
ACATCTTCTGTGGCAAATAACATCGCAGTGGTCACCATAAGAACAAACACCATCACCCATTATGTCATTACTCGC
TCAGGAATAAACACAATCTACTTGGGTACCTTCGCTTCTCAAGAGCCAAGTGTCGGCGAACTTCGTTTTATTGCT
CGTTTATCCAAGTCCGCGCTGCCTCGTGGTATTGCTGAAGCCGAGATTGAGGGTGGATCCGCGATTGAAGGGTCT
GATGTCTTCCGTGTCAATGGGCAGACCCGCTCCAAATTCTATTCCAGTGTCCGATTCATGGAAGATCAAGTTCAT
GGCGTAACCGGTTCTGGAGTTGGCGCGTTCATGATTATTCCTGGCGTTGGTTATGAAACATCTTCCGGTGGCCCA
TTTTTCAGAGATATCAATAATCAAGGTGGCGCTCAACAAGAGCTTTACTTCTATATGAACTCGGGCCATGAGCAA
ACAGAGTCTTATAGAACAGGCTTTTTCGGACCTTATGCTCTCGCCATTACAAGCGGTTCTGCTCCCTCTGGCAAT
CTGGATACGAGCTTCATGGACAACCTTAACCTCCAAGGCTATGTTCCAGCTTCTGGACGTGGAGCCGTTTCTGGG
AGTTACTCCGGCACTTTGTCGGGACCTCCGGTAACCATTGGCTTCAAGAATTCGAATGCGCAGTATTGGATATCT
GGTTCTGGTGGAGGGTTTACAAGAAATATGATGAAGCCCGGGACATACACCGTCACATTATATCAAGGCGAATTT
GCGGCTGGTACTGGTAGTGTATCCGTTTCAGCAGGGAGGACTTCATCTGTCAATTTGAGTTCTAATTTGTCACGC
CCGAACACAATTTGGTCAATCGGTACTGTCGATGGAACGCCCGCCGGGTTCTTGAACGCCGATAAAATCGAGCAT
ATGCACCCATCTGATTCGAGAATGGGAAATTGGGGGCCAACCACTTTCACTATAGGGTCCTCATCCACCTCATCC
TTCCCTATGGCCCAATTCAAAGCGGTGAACAACCCGACTACGATCAGGTGGACGGCTTCTTCTTCACAAACCGGT
GCACGTACTCTCCGTATCCGTACGACCGAGTCATTTGCCGGAGGCAGGCCTCAAGTCACGGTTAACTCTTTCACG
TCATCAGCTCCTCCAGCACCAACTAAAATAGACTCGCGAGGTGTTACTCGAGGTACCTGGAGAGGTCTCAACGAA
GTCTACGACTTCAGTATCCCTTCCGGTGTACTTGTCCAAGGTTCCAATACCATACAGATCAATGTCATCAGTGGT
AGCTCTGGTGACAGTTTCCTTAGTCCTAACTTCGTTTTTGATTCGGTTGAGCTATTTTAG
Gene >AgabiH97|102520
ATGCTACTCCCCTTCTTGAATCTCTTGCTGTGGTTGCCCGCCGCTTTGGCGGCATTTGGGGTAACGACCTCCGGA
AGTAATATGCTCGTTGATTCCGGTGCTGGGCTGGTTACGACCAGTAAGTGTCTCGTGATAACTAAGTATGTCGGG
GTCGGGTTTACTTATCATGACGACATAGTACACACAACAAATGGGGACATTACTTCCATTAGGTTCAACGGAAAA
GAACTGCAGGACCAATCTAAATTCACCCACCTCAGTTCAGGTCTCGGTAAGATCTCCAAGATACGTGTACATTCG
CAGAAAGCTGATTCACTGTAAAGGCTCAGCGTCCGTCACATCTTCTGTGGCAAATAACATCGCAGTGGTCACCAT
AAGAACAAACACCATCGTGAGTATAAACATCCGATATATATATCGAATGTTTTGTTGTTGCGAAGTTGGATTAAT
CAAAAATAAACTCATTGATCTGCAGACCCATTATGTCATTACTCGCTCAGGAATAAACACAATCTACTTGGGTAC
CTTCGCTTCTCAAGAGCCAAGTGTCGGCGAACTTCGTTTTATTGCTCGTTTATCCAAGTCCGCGCTGCCTCGTGG
TATTGCTGAAGCCGAGATTGAGGGTGGATCCGCGATTGAAGGGTCTGATGTCTTCCGTGTCAATGGGCAGACCCG
CTCCAAATTCTATTCCAGTGTCAGTGTGGTTTCTTTGTGCATGCTGCTAACTAACACATACTCATTTGAAACTCG
CCCCGTCAGGTCCGATTCATGGAAGATCAAGTTCATGGCGTAACCGGTTCTGGAGTTGGCGCGTTCATGATTATT
CCTGGCGTTGGTTATGAAACATCTTCCGGTGGCCCATTTTTCAGAGGTGAGATTACATGACGTTACACACATCAC
AATCTTACTTTGGCCTCGTGCTAGATATCAATAATCAAGGTGGCGCTCAACAAGAGCTTTACTTCTATATGAACT
CGGGCCATGAGCAAACAGAGTCTTATAGAACAGGCTTTTTCGGACCGTAAGTTCTTCCAAAGTAGATTTAATATT
TGTCACAGGATTTGACCTCCCGTACAGTTATGCTCTCGCCATTACAAGCGGTTCTGCTCCCTCTGGCAATCTGGA
TACGAGCTTCATGGACAACCTTAACCTCCAAGGCTATGTTCCAGCTTCTGGACGTGGAGCCGTTTCTGGGAGTTA
CTCCGGCACTTTGTCGGGACCTCCGGTAACCATTGGCTTCAAGGTACAAAAAGAAAAGGACTTCGCGTGAAGTAT
CTTTTGCTGAATTTCGATACAGAATTCGAATGCGCAGTATTGGATATCTGGTTCTGGGTGCGTGTTTCCTGGAAT
AAATCGAAATATATATAATTGGGAGCTAACACCACACTTATTTGCAGTGGAGGGTTTACAAGAAATATGATGAAG
CCCGGGACATACACCGTCACATTATATCAAGGCGAATTTGCGGCTGGTACTGGTAGTGTATCCGTTTCAGCAGGG
AGGACTTCATCTGTCAATTTGAGTTCTAATTTGTCACGCCCGAACACAATTTGGTCAATCGGTGTGTAATTCTGA
TAATGGGACGGGAAACGAAGAGAGACTCATGACTTGTTTTCCACTTTTCCAGGTACTGTCGATGGAACGCCCGCC
GGGTAGGCTACATTGTGGATTATCTGTTAAATTTTCTTATGTCTCTCTGAATAGGTTCTTGAACGCCGATAAAAT
CGAGCATATGCACCCGTAAGTCCGTCTGGTAATGTTACTCACATCATAATTGATAATTATGCTCCGTCAAAAGAT
CTGATTCGAGAATGGGAAATTGGGGGCCAACCACTTTCACTATAGGGTCCTCATCCACCTCATCCTTCCCTATGG
CCCAATTCAAAGCGGTATGTCTTTTTTCGCCTTCAGTTCATCCCCGAACTCATTGGTTCCAGGTGAACAACCCGA
CTACGATCAGGTGGACGGCTTCTTCTTCACAAACCGGTCCGTCTATTTGACTATCCCAAACTAAGAATTAAGACT
TAGTATACGACAGGTGCACGTACTCTCCGTATCCGTACGACCGAGTCATTTGCCGGAGGCAGGCCTCAAGTCACG
GTTAACTCTTTCACGTCATCAGCTCCTCCAGGTTTGTTTTTGTTGTTCCACACTACGTGCAAAGTTTCTGAATTC
GTGCATGCTTCTACAGCACCAACTAAAATAGACTCGCGAGGGTGAGTGAAAATCATCAAATTATAGAAAGGAAGT
TATTCTGAATATCCGCAAAAGTGTTACTCGAGGTACCTGGAGAGGTCTCAACGAAGTCTGTAAGTACACTATGCA
GTAGCTTGTATCTGGATTACACTAAAGCAATCACCAAAGACGACTTCAGTATCCCTTCCGGTAAGGCAAATCGCT
GTGGGTTGCATCCGGTCAACTCATCCATCCTTTTCAAAGGTGTACTTGTCCAAGGTTCCAATACCATACAGATCA
ATGTCATCAGTGGTAGCTCTGGTGACAGTTTCCTTAGTCCTAACTTCGTTTTTGATTCGGTTGAGCTATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail