Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102340
Gene name
Locationscaffold_7:1315853..1317171
Strand-
Gene length (bp)1318
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00274 Glycolytic Fructose-bisphosphate aldolase class-I 1.6E-71 41 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86A67|ALF_DICDI Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1 38 356 1.0E-56
sp|Q8P5Z7|ALF1_XANCP Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC3185 PE=3 SV=1 41 373 1.0E-55
sp|P46563|ALF2_CAEEL Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=2 SV=1 53 362 3.0E-55
sp|Q9PF52|ALF1_XYLFA Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain 9a5c) GN=XF_0826 PE=3 SV=1 41 382 4.0E-54
sp|Q8PHB5|ALF1_XANAC Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=XAC3344 PE=3 SV=1 41 382 2.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86A67|ALF_DICDI Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1 38 356 1.0E-56
sp|Q8P5Z7|ALF1_XANCP Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC3185 PE=3 SV=1 41 373 1.0E-55
sp|P46563|ALF2_CAEEL Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=2 SV=1 53 362 3.0E-55
sp|Q9PF52|ALF1_XYLFA Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain 9a5c) GN=XF_0826 PE=3 SV=1 41 382 4.0E-54
sp|Q8PHB5|ALF1_XANAC Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=XAC3344 PE=3 SV=1 41 382 2.0E-53
sp|P53442|ALF_SCHMA Fructose-bisphosphate aldolase OS=Schistosoma mansoni PE=2 SV=1 29 356 6.0E-53
sp|Q87AI0|ALF1_XYLFT Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1 41 382 7.0E-53
sp|P54216|ALF1_CAEEL Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1 32 362 7.0E-53
sp|Q9GP32|ALF_ECHMU Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1 31 356 4.0E-52
sp|P07341|ALDOB_CHICK Fructose-bisphosphate aldolase B OS=Gallus gallus GN=ALDOB PE=3 SV=3 31 357 9.0E-52
sp|P53446|ALF2_LETCA Fructose-bisphosphate aldolase, non-muscle type OS=Lethenteron camtschaticum PE=2 SV=1 29 356 1.0E-51
sp|P14223|ALF_PLAFA Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1 20 370 2.0E-51
sp|Q7KQL9|ALF_PLAF7 Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=1 SV=1 20 370 2.0E-51
sp|P79226|ALDOB_RABIT Fructose-bisphosphate aldolase B OS=Oryctolagus cuniculus GN=ALDOB PE=1 SV=3 31 381 4.0E-51
sp|Q01517|ALFC2_PEA Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2 38 356 4.0E-51
sp|Q944G9|ALFC2_ARATH Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=2 38 356 5.0E-51
sp|Q5R1X4|ALDOC_PANTR Fructose-bisphosphate aldolase C OS=Pan troglodytes GN=ALDOC PE=2 SV=3 31 356 7.0E-51
sp|Q4KMC8|ALDCA_DANRE Fructose-bisphosphate aldolase C-A OS=Danio rerio GN=aldoca PE=2 SV=1 31 364 7.0E-51
sp|P05063|ALDOC_MOUSE Fructose-bisphosphate aldolase C OS=Mus musculus GN=Aldoc PE=1 SV=4 31 356 7.0E-51
sp|P05065|ALDOA_RAT Fructose-bisphosphate aldolase A OS=Rattus norvegicus GN=Aldoa PE=1 SV=2 31 356 1.0E-50
sp|P09972|ALDOC_HUMAN Fructose-bisphosphate aldolase C OS=Homo sapiens GN=ALDOC PE=1 SV=2 31 356 1.0E-50
sp|P49577|ALF2_PLABA Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1 38 382 2.0E-50
sp|Q91Y97|ALDOB_MOUSE Fructose-bisphosphate aldolase B OS=Mus musculus GN=Aldob PE=1 SV=3 31 356 2.0E-50
sp|Q3T0S5|ALDOB_BOVIN Fructose-bisphosphate aldolase B OS=Bos taurus GN=ALDOB PE=2 SV=1 31 370 2.0E-50
sp|Q9GKW3|ALDOC_MACFA Fructose-bisphosphate aldolase C OS=Macaca fascicularis GN=ALDOC PE=2 SV=3 31 356 2.0E-50
sp|P53447|ALDOB_SPAAU Fructose-bisphosphate aldolase B OS=Sparus aurata GN=aldob PE=2 SV=2 31 361 3.0E-50
sp|P05062|ALDOB_HUMAN Fructose-bisphosphate aldolase B OS=Homo sapiens GN=ALDOB PE=1 SV=2 31 356 4.0E-50
sp|P09117|ALDOC_RAT Fructose-bisphosphate aldolase C OS=Rattus norvegicus GN=Aldoc PE=1 SV=3 31 356 4.0E-50
sp|Q9ZU52|ALFC3_ARATH Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1 38 356 4.0E-50
sp|P52210|ALDOB_SHEEP Fructose-bisphosphate aldolase B OS=Ovis aries GN=ALDOB PE=2 SV=2 31 356 4.0E-50
sp|P08440|ALF_MAIZE Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1 40 356 1.0E-49
sp|Q40677|ALFC_ORYSJ Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2 20 356 1.0E-49
sp|Q01516|ALFC1_PEA Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1 38 356 2.0E-49
sp|P00883|ALDOA_RABIT Fructose-bisphosphate aldolase A OS=Oryctolagus cuniculus GN=ALDOA PE=1 SV=2 30 356 2.0E-49
sp|Q5RFA6|ALDOB_PONAB Fructose-bisphosphate aldolase B OS=Pongo abelii GN=ALDOB PE=2 SV=3 31 356 3.0E-49
sp|P05064|ALDOA_MOUSE Fructose-bisphosphate aldolase A OS=Mus musculus GN=Aldoa PE=1 SV=2 31 356 3.0E-49
sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens GN=ALDOA PE=1 SV=2 28 356 6.0E-49
sp|P53448|ALDOC_CARAU Fructose-bisphosphate aldolase C OS=Carassius auratus GN=aldoc PE=2 SV=2 31 364 7.0E-49
sp|Q5NVR5|ALDOA_PONAB Fructose-bisphosphate aldolase A OS=Pongo abelii GN=ALDOA PE=2 SV=3 28 356 2.0E-48
sp|Q8JH70|ALDCB_DANRE Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1 31 364 3.0E-48
sp|Q9SJU4|ALFC1_ARATH Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2 38 365 4.0E-48
sp|A5A6I5|ALDOA_PANTR Fructose-bisphosphate aldolase A OS=Pan troglodytes GN=ALDOA PE=2 SV=1 28 356 4.0E-48
sp|P22197|ALF_ARATH Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2 40 365 5.0E-48
sp|P53445|ALF1_LETCA Fructose-bisphosphate aldolase, muscle type OS=Lethenteron camtschaticum PE=2 SV=1 31 381 5.0E-48
sp|B5DGM7|ALDOA_SALSA Fructose-bisphosphate aldolase A OS=Salmo salar PE=1 SV=1 25 356 7.0E-48
sp|P00884|ALDOB_RAT Fructose-bisphosphate aldolase B OS=Rattus norvegicus GN=Aldob PE=1 SV=2 31 356 1.0E-47
sp|P07752|ALF_TRYBB Fructose-bisphosphate aldolase, glycosomal OS=Trypanosoma brucei brucei GN=ALD PE=1 SV=2 15 356 1.0E-47
sp|P07764|ALF_DROME Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5 32 382 1.0E-47
sp|P17784|ALF_ORYSJ Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2 40 356 3.0E-47
sp|P46257|ALF2_PEA Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1 39 356 3.0E-47
sp|Q8JH71|ALDOB_DANRE Fructose-bisphosphate aldolase B OS=Danio rerio GN=aldob PE=2 SV=1 31 356 4.0E-46
sp|P46256|ALF1_PEA Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1 38 356 8.0E-46
sp|Q42690|ALFC_CHLRE Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=2 39 356 2.0E-45
sp|P29356|ALF_SPIOL Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1 38 365 1.0E-44
sp|O65735|ALF_CICAR Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1 39 365 2.0E-44
sp|P16096|ALFC_SPIOL Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3 38 361 4.0E-44
sp|Q8SSM8|ALF_ENCCU Fructose-bisphosphate aldolase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0240 PE=1 SV=1 53 383 6.0E-33
sp|P91759|ALF_LYMST Fructose-bisphosphate aldolase (Fragment) OS=Lymnaea stagnalis PE=2 SV=1 252 362 6.0E-14
sp|P53449|ALDOC_CHICK Fructose-bisphosphate aldolase C (Fragment) OS=Gallus gallus GN=ALDOC PE=2 SV=1 260 362 6.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004332 fructose-bisphosphate aldolase activity Yes
GO:0006096 glycolytic process Yes
GO:0008150 biological_process No
GO:1901575 organic substance catabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0046031 ADP metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0009259 ribonucleotide metabolic process No
GO:0008152 metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006757 ATP generation from ADP No
GO:0009056 catabolic process No
GO:0019637 organophosphate metabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0046034 ATP metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016832 aldehyde-lyase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0009987 cellular process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0006082 organic acid metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0046939 nucleotide phosphorylation No
GO:0006753 nucleoside phosphate metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0016310 phosphorylation No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0005975 carbohydrate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006090 pyruvate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102340
MLESVPPNLFASPDLTTQLPRPLSPDVFLQPYLSPHAAHDLIKTASALVSPRGKGIYATDESPDAIQALLDGVPL
NDREERTCSSEENRERRKKWREFAYNAVSNEHISGVILYPETLIDFGLAPILTDKGIIPGVRANEELMPIPGSPS
EFIVEGLDGLLGRLQAARAAGARFSKWRVTIACTSKEQGLPTQTSLELQAETLGRFAAISQEAGLVPIVEPDVEF
SQDADLARSVEVHEKAISMIFDRMKAYNVLLEGSVIKPSFPQPGLKNSNKSQCTSEDVAFATATVIARAVPISVP
GVAFLSGGLTSTLATHYLAAVNALVNRSQPPSPFARLPSLTFSFGRALQGDALKEWVKGNDQEAKGLLQKWSRVC
WQSANGNLSS*
Coding >AgabiH97|102340
ATGCTCGAATCGGTCCCCCCTAATCTTTTCGCCAGTCCGGATCTGACAACTCAACTTCCTCGCCCACTTTCGCCA
GATGTCTTTCTCCAACCGTATTTGTCTCCACATGCCGCTCATGACTTGATCAAGACGGCCAGTGCACTTGTATCT
CCTCGTGGCAAGGGTATTTACGCTACCGACGAGTCGCCCGATGCTATCCAGGCTCTCCTTGACGGTGTTCCGTTA
AATGACCGTGAGGAAAGGACTTGTTCTTCGGAAGAAAACAGGGAACGCAGGAAGAAATGGAGAGAGTTTGCTTAT
AACGCCGTTTCCAATGAACATATATCTGGTGTTATCCTCTATCCAGAAACCTTAATCGATTTTGGGCTTGCACCC
ATTCTCACAGATAAAGGCATAATTCCCGGCGTGCGCGCAAATGAGGAACTTATGCCCATCCCCGGTTCACCTTCT
GAGTTCATAGTTGAGGGACTCGACGGGTTGCTTGGGCGTCTTCAAGCGGCTCGGGCAGCTGGTGCACGTTTCTCC
AAGTGGCGTGTAACAATCGCTTGCACTTCAAAGGAACAAGGGTTACCTACACAAACTTCTCTGGAGCTGCAAGCC
GAAACCCTAGGCCGGTTCGCCGCTATCAGCCAAGAAGCTGGATTGGTTCCAATTGTGGAACCTGATGTTGAGTTT
TCTCAGGATGCTGATCTAGCCAGAAGTGTCGAGGTTCACGAGAAAGCGATCTCGATGATTTTTGACCGCATGAAA
GCGTATAATGTGCTGCTCGAAGGATCTGTCATTAAACCGTCCTTCCCCCAGCCTGGTTTAAAGAATTCCAACAAA
AGTCAATGCACGTCTGAGGACGTTGCCTTTGCTACGGCGACAGTGATTGCCCGAGCCGTGCCTATTTCTGTTCCT
GGGGTTGCATTCCTATCTGGCGGACTAACGTCTACGCTGGCCACGCACTATCTTGCGGCCGTGAACGCCCTTGTG
AATCGCTCTCAGCCGCCGTCTCCTTTTGCACGCCTGCCGTCGTTAACGTTTTCCTTCGGCCGAGCTTTGCAGGGT
GATGCTTTAAAGGAATGGGTTAAAGGAAATGACCAGGAGGCGAAAGGATTATTGCAGAAGTGGTCTAGAGTCTGC
TGGCAATCCGCAAATGGAAACTTATCAAGTTAA
Transcript >AgabiH97|102340
ATGCTCGAATCGGTCCCCCCTAATCTTTTCGCCAGTCCGGATCTGACAACTCAACTTCCTCGCCCACTTTCGCCA
GATGTCTTTCTCCAACCGTATTTGTCTCCACATGCCGCTCATGACTTGATCAAGACGGCCAGTGCACTTGTATCT
CCTCGTGGCAAGGGTATTTACGCTACCGACGAGTCGCCCGATGCTATCCAGGCTCTCCTTGACGGTGTTCCGTTA
AATGACCGTGAGGAAAGGACTTGTTCTTCGGAAGAAAACAGGGAACGCAGGAAGAAATGGAGAGAGTTTGCTTAT
AACGCCGTTTCCAATGAACATATATCTGGTGTTATCCTCTATCCAGAAACCTTAATCGATTTTGGGCTTGCACCC
ATTCTCACAGATAAAGGCATAATTCCCGGCGTGCGCGCAAATGAGGAACTTATGCCCATCCCCGGTTCACCTTCT
GAGTTCATAGTTGAGGGACTCGACGGGTTGCTTGGGCGTCTTCAAGCGGCTCGGGCAGCTGGTGCACGTTTCTCC
AAGTGGCGTGTAACAATCGCTTGCACTTCAAAGGAACAAGGGTTACCTACACAAACTTCTCTGGAGCTGCAAGCC
GAAACCCTAGGCCGGTTCGCCGCTATCAGCCAAGAAGCTGGATTGGTTCCAATTGTGGAACCTGATGTTGAGTTT
TCTCAGGATGCTGATCTAGCCAGAAGTGTCGAGGTTCACGAGAAAGCGATCTCGATGATTTTTGACCGCATGAAA
GCGTATAATGTGCTGCTCGAAGGATCTGTCATTAAACCGTCCTTCCCCCAGCCTGGTTTAAAGAATTCCAACAAA
AGTCAATGCACGTCTGAGGACGTTGCCTTTGCTACGGCGACAGTGATTGCCCGAGCCGTGCCTATTTCTGTTCCT
GGGGTTGCATTCCTATCTGGCGGACTAACGTCTACGCTGGCCACGCACTATCTTGCGGCCGTGAACGCCCTTGTG
AATCGCTCTCAGCCGCCGTCTCCTTTTGCACGCCTGCCGTCGTTAACGTTTTCCTTCGGCCGAGCTTTGCAGGGT
GATGCTTTAAAGGAATGGGTTAAAGGAAATGACCAGGAGGCGAAAGGATTATTGCAGAAGTGGTCTAGAGTCTGC
TGGCAATCCGCAAATGGAAACTTATCAAGTTAA
Gene >AgabiH97|102340
ATGCTCGAATCGGTCCCCCCTAATCTTTTCGCCAGTCCGGATCTGACAACTCAACTTCCTCGCCCACTTTCGCCA
GATGTCTTTCTCCAACCGTATTTGTCTCCACATGCCGCTCATGACTTGATCAAGACGGCCAGTGCACTTGTATCT
CCTCGTGGCAAGGGTATTTACGCTACCGACGAGTCGCCCGATGCTATCCAGGCTCTCCTTGACGGTGTTCCGTTA
AATGACCGTGAGGAAAGGACTTGTTCTTCGGAAGAAAACAGGGAACGCAGGAAGAAATGGAGAGAGTTTGCTTAT
AACGCCGTTTCCAATGGTAAGCAATCATCATGTAAATATGACCCCTCTGACAGCATCTTGTACACAGAACATATA
TCTGGTGTTATCCTCTATCCAGAAACCTTAATCGATTTTGGGCTTGCACCCATTCTCACAGATAAAGGCATAATT
CCCGGCGTGCGCGCAAATGAGGAACTTATGCCCATCCCCGGTTCACCTTCTGAGTTCATAGTTGAGGGACTCGAC
GGGTTGCTTGGGCGTCTTCAAGCGGCTCGGGCAGCTGGTGCACGTTTCTCCAAGTGGCGTGTAACAATCGCTTGC
ACTTCAAAGGAACAAGGGTTACCTACACAAACTTCTCTGGAGCTGCAAGCCGAAACCCTAGGCCGGTTCGCCGCT
ATCAGCCAAGAAGCTGGATTGGTTCCAATTGTGGAACCTGATGTTGAGTTTTCTCAGGATGCTGATCTAGCCAGA
AGTGTCGAGGTTCACGAGAAAGCGATCTCGATGATTTTTGACCGCATGAAAGCGTATAATGTGCTGCTCGAAGGT
CAGTACTAATGTGGGTATCATTCAGGATAATGCGACCTGAGTACCCTATTCGATACAGGATCTGTCATTAAACCG
TCCTTCCCCCAGCCTGGTTTAAAGAATTCCAACAAAAGTCAATGCACGTCTGAGGACGTTGCCTTTGCTACGGCG
ACAGTGATTGCCCGAGCCGTGCCTATTTCTGTTCCTGGGGTTGCATTCCTATCTGGTACATTGAATCATATACTG
TCGCTTTCTTTATCTGATTTTTCGTTTAGGCGGACTAACGTCTACGCTGGCCACGCACTATCTTGCGGCCGTGAA
CGCCCTTGTGAATCGCTCTCAGCCGCCGTCTCCTTTTGCACGCCTGCCGTCGTTAACGTTTTCCTTCGGCCGAGC
TTTGCAGGGTGATGCTTTAAAGGAATGGGTTAAAGGAAATGACCAGGAGGCGAAAGGATTATTGCAGAAGTGGTC
TAGAGTCTGCTGGCAATCCGCAAATGGAAACTTATCAAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail