Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102320
Gene name
Locationscaffold_7:1311570..1314890
Strand-
Gene length (bp)3320
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01344 Kelch_1 Kelch motif 5.1E-05 141 181
PF07646 Kelch_2 Kelch motif 2.0E-04 141 181
PF13418 Kelch_4 Galactose oxidase, central domain 4.0E-04 142 183
PF13415 Kelch_3 Galactose oxidase, central domain 2.1E-06 32 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 15 597 1.0E-83
sp|Q5ADT1|MDS3_CANAL Negative regulator of sporulation MDS3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDS3 PE=1 SV=1 44 374 3.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 33 175 6.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 33 175 8.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 33 175 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 15 597 1.0E-83
sp|Q5ADT1|MDS3_CANAL Negative regulator of sporulation MDS3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDS3 PE=1 SV=1 44 374 3.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 33 175 6.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 33 175 8.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 33 175 2.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 15 134 1.0E-10
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 14 161 2.0E-10
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 14 161 3.0E-10
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 14 161 5.0E-10
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 14 161 8.0E-10
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 34 175 8.0E-10
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 34 175 2.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 14 175 3.0E-09
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 17 155 1.0E-08
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 14 161 2.0E-08
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 27 180 2.0E-08
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 5 204 5.0E-08
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 13 159 5.0E-08
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 15 180 6.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 27 161 7.0E-08
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 16 204 7.0E-08
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 14 161 8.0E-08
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 17 183 1.0E-07
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 17 182 2.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 25 182 2.0E-07
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 17 122 3.0E-07
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 16 187 3.0E-07
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 17 183 3.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 12 182 3.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 4 180 4.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 12 182 4.0E-07
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 16 237 5.0E-07
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 5 186 6.0E-07
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 4 180 8.0E-07
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 12 182 8.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 12 182 9.0E-07
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 13 281 1.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 13 160 2.0E-06
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 5 204 2.0E-06
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 19 178 2.0E-06
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 19 179 2.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 19 179 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 33 182 2.0E-06
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 17 180 4.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 17 180 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102320
MLHSIYDLTTLCRKTTGDVPPKLVGASTTVVGSKMYLFGGRLVTERRMTSDLYMFDLETFDWEYIQPFPEDSAPR
PRYFHSTDSWNNHLVLFGGMSNRPDSPNPEDLCVLSDVRFFDLETRHWLPEESSDTSLEDPNIPRARYAHLSSVT
SNRLFIIGGQDFFNTWLDDVCVYDLAKRSWVQRRDYPRHCGTYRSVAVASTSIVRIPKDEAQASRSLSALGPPGT
RFQMDKTTPLIEITPSNTLTHLSYTADPTDEHPSEIFLYSNYNFTDVKRELEVFSPSPDVDFTIEDRSDHMTGST
LPPGLRFPTGAVLGTYLIIAGTYLAHSYQSFSIWVLDLVSMTWSRIDPGKAIETGSWFRGCLWAEGNKFLIFGNR
NGNLVDDYNHRLLSWDHVAVIDLEAFGIYQPPSLKVDIRMQELGLAALEERCLTDFEIVCDDGRKIPCSRKLLEE
RWPWFELQRTQMLQRAQAALSRLPASAMHAELPTIPGTASVGDTQLDPRLTPRQLFLSEPWPVTMALLQYFYSMA
LITPLQHSPAVLSQLLILGATYQLDHLVSLVKHAMHGALTNSTSVGVYEVATLCSCRSLQIRALKTVMSYTQKKP
PKSRQDKDKDNGNDRHSGDSGGPNGANGKNDNSHDDDGGGGAFSSRPRGTSDARWRTLGGSGAPSGTSYVSRGGN
IPSPPVKKSDSQKSRERSLTTPVAYRPPCSVPSLMHGPKRQSILEPSLSPSRTRENHAPAENLRTHRRSHSSKAS
DEWHKASPATGMSLQKSLPVTPKIQTTSHYTGINKPVSPTSLTKTSIRSKSPTTPTRQRPSPILTDITGRNIMIL
AERTHHTPNSSSSSSRSSFSSTNHILKTPITSYNKGMNPKVSDYSTRHNGNGTEDGFTIVPSGDEAVHTPDLQPS
PTRAKWTVHHRSNSSFDSSPQSKPHLPQKTLPFAPFSPTTQSLLASRVQLDSRRTKPSNYPGPNHDATTIFGDSQ
SQPI*
Coding >AgabiH97|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGGT
GCCTCTACGACCGTAGTAGGCTCTAAAATGTATCTTTTCGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCT
GACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGAATACATTCAACCTTTCCCCGAAGACAGTGCCCCGAGG
CCTCGGTATTTCCACAGTACTGATTCTTGGAACAACCATCTCGTCCTCTTCGGTGGTATGAGCAATCGGCCGGAC
TCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACTCGTCACTGGTTGCCC
GAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCACCTATCTTCTGTGACT
TCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTCTGTGTTTATGACCTC
GCGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGTGTCGCCGTTGCCTCA
ACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTCGGTCCTCCTGGAACT
AGATTTCAGATGGACAAGACGACGCCGCTGATAGAAATTACTCCATCAAACACTCTCACACATCTCTCCTACACC
GCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATTTTACCGATGTCAAACGAGAG
CTCGAAGTATTTTCTCCCTCACCCGACGTCGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACT
CTTCCTCCTGGTCTTCGTTTCCCCACAGGCGCTGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCC
CACAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAG
GCAATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGG
AATGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCG
TTTGGGATCTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAG
AGGTGTCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTGGAAGAA
CGTTGGCCCTGGTTCGAACTACAGCGAACGCAGATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCT
TCCGCTATGCATGCCGAGCTTCCTACCATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTC
ACTCCTCGCCAGCTCTTTTTATCAGAGCCTTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCT
CTTATCACCCCGCTCCAGCATAGTCCTGCGGTTTTAAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGAC
CACTTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTT
GCTACTCTATGCAGTTGTAGAAGTCTGCAAATCAGAGCCCTCAAGACCGTGATGTCATATACCCAGAAGAAACCT
CCGAAATCTCGACAAGATAAGGACAAGGACAATGGGAATGACCGACATTCCGGAGACTCGGGTGGGCCTAACGGA
GCAAATGGCAAAAACGACAACTCTCACGATGATGATGGTGGTGGTGGTGCTTTCTCTTCTCGGCCAAGAGGAACT
TCAGACGCGCGTTGGAGAACACTTGGCGGTAGCGGCGCACCCAGCGGCACCTCGTATGTATCTCGGGGTGGTAAC
ATACCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGGCATAT
CGACCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTATCACCA
TCACGAACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGGCTTCT
GACGAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGGTGACGCCTAAAATACAA
ACGACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAACCAAGACTAGCATACGTTCGAAA
TCGCCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGATTCTT
GCTGAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACCATATA
CTGAAGACGCCCATAACGTCATACAATAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACAACGGG
AACGGCACGGAAGATGGTTTTACGATAGTTCCAAGCGGAGACGAAGCAGTCCATACCCCCGATCTACAACCAAGT
CCGACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCTTCGACTCTTCACCCCAATCCAAGCCACAT
CTACCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTCAGCTA
GATAGCAGAAGAACAAAACCGAGCAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACAGCCAA
TCCCAGCCTATATAA
Transcript >AgabiH97|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGGT
GCCTCTACGACCGTAGTAGGCTCTAAAATGTATCTTTTCGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCT
GACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGAATACATTCAACCTTTCCCCGAAGACAGTGCCCCGAGG
CCTCGGTATTTCCACAGTACTGATTCTTGGAACAACCATCTCGTCCTCTTCGGTGGTATGAGCAATCGGCCGGAC
TCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACTCGTCACTGGTTGCCC
GAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCACCTATCTTCTGTGACT
TCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTCTGTGTTTATGACCTC
GCGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGTGTCGCCGTTGCCTCA
ACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTCGGTCCTCCTGGAACT
AGATTTCAGATGGACAAGACGACGCCGCTGATAGAAATTACTCCATCAAACACTCTCACACATCTCTCCTACACC
GCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATTTTACCGATGTCAAACGAGAG
CTCGAAGTATTTTCTCCCTCACCCGACGTCGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACT
CTTCCTCCTGGTCTTCGTTTCCCCACAGGCGCTGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCC
CACAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAG
GCAATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGG
AATGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCG
TTTGGGATCTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAG
AGGTGTCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTGGAAGAA
CGTTGGCCCTGGTTCGAACTACAGCGAACGCAGATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCT
TCCGCTATGCATGCCGAGCTTCCTACCATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTC
ACTCCTCGCCAGCTCTTTTTATCAGAGCCTTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCT
CTTATCACCCCGCTCCAGCATAGTCCTGCGGTTTTAAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGAC
CACTTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTT
GCTACTCTATGCAGTTGTAGAAGTCTGCAAATCAGAGCCCTCAAGACCGTGATGTCATATACCCAGAAGAAACCT
CCGAAATCTCGACAAGATAAGGACAAGGACAATGGGAATGACCGACATTCCGGAGACTCGGGTGGGCCTAACGGA
GCAAATGGCAAAAACGACAACTCTCACGATGATGATGGTGGTGGTGGTGCTTTCTCTTCTCGGCCAAGAGGAACT
TCAGACGCGCGTTGGAGAACACTTGGCGGTAGCGGCGCACCCAGCGGCACCTCGTATGTATCTCGGGGTGGTAAC
ATACCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGGCATAT
CGACCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTATCACCA
TCACGAACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGGCTTCT
GACGAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGGTGACGCCTAAAATACAA
ACGACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAACCAAGACTAGCATACGTTCGAAA
TCGCCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGATTCTT
GCTGAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACCATATA
CTGAAGACGCCCATAACGTCATACAATAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACAACGGG
AACGGCACGGAAGATGGTTTTACGATAGTTCCAAGCGGAGACGAAGCAGTCCATACCCCCGATCTACAACCAAGT
CCGACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCTTCGACTCTTCACCCCAATCCAAGCCACAT
CTACCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTCAGCTA
GATAGCAGAAGAACAAAACCGAGCAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACAGCCAA
TCCCAGCCTATATAA
Gene >AgabiH97|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGTA
CGTGTCCTATCCTCACGCGTACAAACAGCAGGGAGTCGATTCTTCTGCTGAACAGGGTGCCTCTACGACCGTAGT
AGGCTCTAAAATGTATCTTTTCGTGAGGACTTCCCCATTGCAACTGTGTGTTCAAAATTTCGCTCATACTCGCTA
GGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCTGACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGA
ATACATTCAACCTTTCCCCGAAGACAGTGCCCCGAGGCCTCGGTATTTCCACAGTACTGATTCTTGTGAGTTCAG
TCATGTGGAGCACCATCTTGTAGTTGATTTTTTAATATGTTAGGGAACAACCATCTCGTCCTCTTCGGTGGTATG
AGCAATCGGCCGGACTCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACT
CGTCACTGGTTGCCCGAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCAC
CTATCTTCTGTGACTTCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTC
TGTGTTTATGACCTCGCGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGT
GTCGCCGTTGCCTCAACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTC
GGTCCTCCTGGAACTAGATTTCAGATGGACAAGACGACGCCGCTGATAGAAATTACTCCATCAAACACTCTCACA
CATCTCTCCTACACCGCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATGTGGGT
TATCTTTCATCTTACTACTTGATGCTAATTTGCGATTGAATTTCAAATATAGTTTACCGATGTCAAACGAGAGCT
CGAAGTATTTTCTCCCTCACCCGACGTCGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACTCT
TCCTCCTGGTCTTCGTTTCCCCACAGGCGCTGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCCCA
CAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAGGC
AATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGGAA
TGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCGTT
TGGGATCTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAGAG
GTGTCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTGGAAGAACG
TTGGCCCTGGTTCGAACTACAGCGAACGCAGATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCTTC
CGCTATGCATGCCGAGCTTCCTACCATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTCAC
TCCTCGCCAGCTCTTTTTATCAGAGCCTTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCTCT
TATCACCCCGCTCCAGCATAGTCCTGCGGTTTTAAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGACCA
CTTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTTGC
TACTCTATGCAGTTGTAGAAGTCTGCAAATCAGGCTAGTTTTTTCAGATAAAATTCAAGCTGATCAACTAAGTAA
TCCACTCTTATAGAGCCCTCAAGACCGTGATGGTGCATAAACTCCTCCATTTTCCTGTTAATCACCCTGACATGT
TTTCTCCAGTCATATACCCAGAAGAAACCTCCGAAATCTCGACAAGATAAGGACAAGGACAATGGGAATGACCGA
CATTCCGGAGACTCGGGTGGGCCTAACGGAGCAAATGGCAAAAACGACAACTCTCACGATGATGATGGTGGTGGT
GGTGCTTTCTCTTCTCGGCCAAGAGGAACTTCAGACGCGCGTTGGAGAACACTTGGCGGTAGCGGCGCACCCAGC
GGCACCTCGTATGGTGAGGTCTCTTAATGACATATTTCGAATTTGCTAACTTACCAACATTAGTATCTCGGGGTG
GTAACATACCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGG
CATATCGACCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTAT
CACCATCACGAACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGG
CTTCTGACGAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGGTGACGCCTAAAA
TACAAACGACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAACCAAGACTAGCATACGTT
CGAAATCGCCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGA
TTCTTGCTGAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACC
ATATACTGAAGACGCCCATAACGTCATACAATAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACA
ACGGGAACGGCACGGAAGATGGTTTTACGATAGTTCCAAGCGGAGACGAAGCAGTCCATACCCCCGATCTACAAC
CAAGTCCGACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCTTCGACTCTTCACCCCAATCCAAGC
CACATCTACCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTC
AGCTAGATAGCAGAAGAACAAAACCGAGCAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACA
GCCAATCCCAGCCTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail