Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102270
Gene name
Locationscaffold_7:1298225..1301249
Strand+
Gene length (bp)3024
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19036 Fuz_longin_1 First Longin domain of FUZ, MON1 and HPS1 8.6E-25 163 286
PF19038 Fuz_longin_3 Third Longin domain of FUZ, MON1 and HPS1 3.8E-24 482 585
PF09597 IGR IGR protein motif 3.8E-22 681 733
PF19037 Fuz_longin_2 Second Longin domain of FUZ, MON1 and HPS1 2.6E-17 326 434

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO83|MON1_CRYNB Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MON1 PE=3 SV=1 94 594 9.0E-136
sp|P0CO82|MON1_CRYNJ Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MON1 PE=3 SV=1 94 594 1.0E-135
sp|Q4PA36|MON1_USTMA Vacuolar fusion protein MON1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MON1 PE=3 SV=1 161 593 1.0E-78
sp|Q5ZIH2|MON1A_CHICK Vacuolar fusion protein MON1 homolog A OS=Gallus gallus GN=MON1A PE=2 SV=1 157 590 3.0E-76
sp|Q6PDG8|MON1A_MOUSE Vacuolar fusion protein MON1 homolog A OS=Mus musculus GN=Mon1a PE=1 SV=3 157 590 2.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO83|MON1_CRYNB Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MON1 PE=3 SV=1 94 594 9.0E-136
sp|P0CO82|MON1_CRYNJ Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MON1 PE=3 SV=1 94 594 1.0E-135
sp|Q4PA36|MON1_USTMA Vacuolar fusion protein MON1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MON1 PE=3 SV=1 161 593 1.0E-78
sp|Q5ZIH2|MON1A_CHICK Vacuolar fusion protein MON1 homolog A OS=Gallus gallus GN=MON1A PE=2 SV=1 157 590 3.0E-76
sp|Q6PDG8|MON1A_MOUSE Vacuolar fusion protein MON1 homolog A OS=Mus musculus GN=Mon1a PE=1 SV=3 157 590 2.0E-73
sp|Q17QV2|MON1A_BOVIN Vacuolar fusion protein MON1 homolog A OS=Bos taurus GN=MON1A PE=2 SV=1 164 590 3.0E-73
sp|Q9YGN1|SAND_TAKRU Protein SAND OS=Takifugu rubripes GN=sand PE=3 SV=1 125 590 3.0E-73
sp|Q86VX9|MON1A_HUMAN Vacuolar fusion protein MON1 homolog A OS=Homo sapiens GN=MON1A PE=1 SV=2 157 590 5.0E-73
sp|Q95KG9|MON1A_MACFA Vacuolar fusion protein MON1 homolog A OS=Macaca fascicularis GN=MON1A PE=2 SV=2 157 590 6.0E-73
sp|Q2ULR1|MON1_ASPOR Vacuolar fusion protein mon1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mon1 PE=3 SV=1 161 590 9.0E-72
sp|Q4I6S5|MON1_GIBZE Vacuolar fusion protein MON1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MON1 PE=3 SV=2 161 590 2.0E-68
sp|A1CEH4|MON1_ASPCL Vacuolar fusion protein mon1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mon1 PE=3 SV=1 161 590 9.0E-68
sp|Q5BBI7|MON1_EMENI Vacuolar fusion protein mon1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mon1 PE=3 SV=1 161 590 2.0E-67
sp|Q1E8Q5|MON1_COCIM Vacuolar fusion protein MON1 OS=Coccidioides immitis (strain RS) GN=MON1 PE=3 SV=2 161 590 7.0E-66
sp|Q0U822|MON1_PHANO Vacuolar fusion protein MON1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MON1 PE=3 SV=1 161 579 1.0E-65
sp|Q4WHL1|MON1_ASPFU Vacuolar fusion protein mon1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mon1 PE=3 SV=2 161 590 2.0E-65
sp|Q8BMQ8|MON1B_MOUSE Vacuolar fusion protein MON1 homolog B OS=Mus musculus GN=Mon1b PE=2 SV=1 161 600 8.0E-64
sp|Q7L1V2|MON1B_HUMAN Vacuolar fusion protein MON1 homolog B OS=Homo sapiens GN=MON1B PE=1 SV=1 161 601 1.0E-62
sp|Q4R4E4|MON1B_MACFA Vacuolar fusion protein MON1 homolog B OS=Macaca fascicularis GN=MON1B PE=2 SV=1 161 601 4.0E-62
sp|Q2HFQ4|MON1_CHAGB Vacuolar fusion protein MON1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MON1 PE=3 SV=1 161 590 7.0E-60
sp|Q870Q4|MON1_NEUCR Vacuolar fusion protein mon1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-13 PE=3 SV=1 161 590 1.0E-58
sp|Q6CCU8|MON1_YARLI Vacuolar fusion protein MON1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MON1 PE=3 SV=1 155 590 9.0E-57
sp|Q0CJY1|MON1_ASPTN Vacuolar fusion protein mon1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mon1 PE=3 SV=1 161 502 2.0E-51
sp|Q6FU19|MON1_CANGA Vacuolar fusion protein MON1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MON1 PE=3 SV=1 159 593 1.0E-42
sp|P53129|MON1_YEAST Vacuolar fusion protein MON1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MON1 PE=1 SV=2 161 593 1.0E-38
sp|Q10150|MON1_SCHPO Vacuolar fusion protein mon1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mon1 PE=3 SV=1 161 591 4.0E-33
sp|Q75EA2|MON1_ASHGO Vacuolar fusion protein MON1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MON1 PE=3 SV=2 159 593 2.0E-30
sp|Q6CKL5|MON1_KLULA Vacuolar fusion protein MON1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MON1 PE=3 SV=1 161 590 8.0E-24
sp|Q5A723|MON1_CANAL Vacuolar fusion protein MON1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MON1 PE=3 SV=1 161 590 1.0E-18
sp|Q6C3R3|FYV4_YARLI Protein FYV4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FYV4 PE=3 SV=2 678 764 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102270
MSHTPRSRTVSRPTPPSLGAHIASPPRLVIPPLRPSPSLSSLHIHSHGTPTPNEPEVPPVPYPQRDQVLESSASS
VVNVETNEGIWIQDMDTDTDITEEDPFEAARPVAATNEESKKFLRDQLRKTLSDQQGHRSPVLRSKKLHPDLQEL
AYGGVARFLPREYYVLTDAGKPVFISRPGGSNSDGMVSTIGIMQALISVFIDDGDKIRCINAGQSRITFLLRPPL
YYVCVSSWGEPESVTRTHLEYLHLQILSIVTASQLRRIFERRTNFDLRRLLDGAETFLTTLLDELEFDLAISSSS
LHCLKLEPSLRKKIADSLVPTGKVKDLLYVMLMAGGRVVTLIRPRKHSVHPADVHILLNTVNSPSICNSQASASW
IPVCLPKFNPSGFVNAYISFPLRDNPLLDPSLPPSAASTSSLKSDDETPDTNIIMICISGSGDFDYVKTWCDVAT
KKLVTDGSLHALAKTILSHQCVYTVTEVGVPGLRHFVYKSRAQVQITLPVFEDPYNGANEKRRLVTLYQLLHDAI
HAKSGQSEPLKLQYIRTDTESVMGWITQPFELYVAVSPLLPKSAIIGAANAVVRWVKKEESRLFLRDAPEHFAVP
VREEVVDLDHVAQDLRTPDHVLHSIVMLAGLGSFARICVSAPKFTRTLVDKSALRSVPKPRIFPKQVGKFVLPLD
VSTPREFLKAIGRSSEKQLQPESWDALWKMSGKDMREAGIAVRDRRYILWCMEKYRQGLDPRDFAHEPKPKKTVR
GWGPSVQNGKRIRSRRVKQRSKRSK*
Coding >AgabiH97|102270
ATGTCACATACCCCTCGCTCCCGGACAGTCTCTCGTCCAACCCCGCCCAGCCTTGGCGCTCACATTGCTTCTCCT
CCCCGCCTTGTCATTCCTCCTTTGCGACCCTCCCCTTCACTTTCAAGCCTGCATATCCACAGTCACGGCACGCCG
ACACCCAATGAGCCCGAGGTCCCTCCTGTTCCTTACCCTCAACGAGACCAAGTTTTGGAGAGCTCAGCTTCGTCT
GTCGTGAACGTGGAAACCAATGAAGGCATATGGATTCAGGACATGGATACCGACACTGACATTACTGAGGAAGAC
CCTTTTGAAGCCGCACGCCCGGTTGCAGCAACAAACGAGGAGTCTAAGAAATTTCTGCGAGATCAGCTAAGGAAA
ACCCTTTCGGACCAGCAAGGACATAGATCGCCTGTTCTCAGGTCCAAGAAGCTACATCCCGATCTTCAGGAACTG
GCATATGGGGGTGTTGCTCGGTTTTTACCCCGAGAGTATTACGTGCTCACCGATGCTGGGAAGCCCGTATTCATA
AGTCGGCCAGGGGGTTCTAACTCGGATGGCATGGTATCAACCATCGGCATAATGCAAGCTCTTATATCCGTCTTC
ATCGATGATGGTGACAAGATACGATGTATAAATGCTGGACAGTCGAGGATCACCTTTCTATTGCGCCCTCCTCTT
TACTATGTTTGCGTTTCGTCATGGGGTGAACCTGAATCTGTCACTAGAACTCACCTGGAATACTTACACCTCCAA
ATCTTAAGCATTGTGACTGCTTCGCAATTAAGGAGAATATTCGAACGGAGGACTAATTTCGACCTACGACGCTTG
CTTGATGGTGCTGAAACATTCCTTACGACATTACTTGACGAACTCGAATTTGATCTAGCCATCAGCTCCTCCTCT
CTGCATTGTCTCAAATTAGAACCAAGCCTAAGGAAGAAGATCGCGGATTCATTGGTGCCAACTGGCAAAGTCAAA
GACTTACTTTACGTCATGCTCATGGCTGGAGGTCGCGTCGTCACTCTCATTCGGCCAAGGAAGCACTCCGTTCAC
CCTGCAGATGTCCATATTCTCTTGAACACGGTCAATTCTCCTTCTATATGTAATTCACAGGCATCGGCCTCTTGG
ATCCCCGTTTGTCTTCCAAAGTTTAATCCGTCTGGCTTCGTGAACGCATATATATCGTTCCCACTTCGTGACAAC
CCCTTGTTGGATCCAAGTCTCCCGCCCTCAGCCGCCTCAACGAGCTCCCTCAAATCAGATGATGAAACTCCAGAT
ACTAATATCATCATGATTTGTATCAGCGGCAGCGGAGATTTCGACTACGTCAAAACTTGGTGTGACGTTGCGACG
AAAAAACTTGTTACCGATGGATCCTTACACGCGTTGGCCAAAACCATTCTATCACATCAATGTGTTTATACAGTC
ACCGAAGTTGGCGTCCCTGGGCTCCGGCACTTCGTATACAAGTCCCGTGCACAAGTTCAGATCACCTTGCCCGTT
TTCGAAGACCCATATAATGGCGCCAACGAGAAACGAAGACTGGTTACCTTGTATCAGCTATTGCATGATGCGATC
CATGCGAAGTCTGGCCAGTCAGAGCCTCTGAAACTTCAGTATATTCGTACGGATACCGAAAGTGTGATGGGCTGG
ATCACTCAACCATTCGAACTTTATGTTGCGGTTTCTCCGCTACTGCCTAAAAGCGCCATAATAGGAGCTGCAAAC
GCAGTTGTACGATGGGTGAAGAAAGAGGAATCTAGGTTATTCTTGCGCGATGCACCAGAACATTTCGCCGTCCCA
GTTCGTGAAGAAGTTGTTGACCTGGATCACGTGGCCCAAGATTTGCGGACGCCGGACCACGTTCTTCATTCCATC
GTCATGCTGGCTGGCTTGGGCTCCTTTGCTCGAATTTGCGTGTCTGCACCAAAGTTCACGCGTACATTAGTCGAC
AAGTCTGCCCTACGCTCTGTCCCGAAACCCCGCATCTTTCCCAAACAAGTTGGAAAATTCGTTCTGCCACTAGAT
GTTTCAACTCCCCGGGAGTTCCTCAAAGCCATAGGACGTTCATCGGAAAAACAGTTGCAGCCTGAGTCATGGGAT
GCTCTTTGGAAGATGTCGGGGAAGGATATGCGAGAAGCTGGTATAGCGGTCAGGGATCGAAGGTATATTCTATGG
TGTATGGAGAAATATCGACAAGGTCTTGACCCGCGAGATTTCGCTCATGAGCCAAAGCCCAAGAAGACTGTGAGG
GGTTGGGGTCCTTCGGTCCAGAATGGCAAACGAATACGTTCGAGGCGGGTGAAACAACGTTCGAAGCGGTCAAAA
TAG
Transcript >AgabiH97|102270
ATGTCACATACCCCTCGCTCCCGGACAGTCTCTCGTCCAACCCCGCCCAGCCTTGGCGCTCACATTGCTTCTCCT
CCCCGCCTTGTCATTCCTCCTTTGCGACCCTCCCCTTCACTTTCAAGCCTGCATATCCACAGTCACGGCACGCCG
ACACCCAATGAGCCCGAGGTCCCTCCTGTTCCTTACCCTCAACGAGACCAAGTTTTGGAGAGCTCAGCTTCGTCT
GTCGTGAACGTGGAAACCAATGAAGGCATATGGATTCAGGACATGGATACCGACACTGACATTACTGAGGAAGAC
CCTTTTGAAGCCGCACGCCCGGTTGCAGCAACAAACGAGGAGTCTAAGAAATTTCTGCGAGATCAGCTAAGGAAA
ACCCTTTCGGACCAGCAAGGACATAGATCGCCTGTTCTCAGGTCCAAGAAGCTACATCCCGATCTTCAGGAACTG
GCATATGGGGGTGTTGCTCGGTTTTTACCCCGAGAGTATTACGTGCTCACCGATGCTGGGAAGCCCGTATTCATA
AGTCGGCCAGGGGGTTCTAACTCGGATGGCATGGTATCAACCATCGGCATAATGCAAGCTCTTATATCCGTCTTC
ATCGATGATGGTGACAAGATACGATGTATAAATGCTGGACAGTCGAGGATCACCTTTCTATTGCGCCCTCCTCTT
TACTATGTTTGCGTTTCGTCATGGGGTGAACCTGAATCTGTCACTAGAACTCACCTGGAATACTTACACCTCCAA
ATCTTAAGCATTGTGACTGCTTCGCAATTAAGGAGAATATTCGAACGGAGGACTAATTTCGACCTACGACGCTTG
CTTGATGGTGCTGAAACATTCCTTACGACATTACTTGACGAACTCGAATTTGATCTAGCCATCAGCTCCTCCTCT
CTGCATTGTCTCAAATTAGAACCAAGCCTAAGGAAGAAGATCGCGGATTCATTGGTGCCAACTGGCAAAGTCAAA
GACTTACTTTACGTCATGCTCATGGCTGGAGGTCGCGTCGTCACTCTCATTCGGCCAAGGAAGCACTCCGTTCAC
CCTGCAGATGTCCATATTCTCTTGAACACGGTCAATTCTCCTTCTATATGTAATTCACAGGCATCGGCCTCTTGG
ATCCCCGTTTGTCTTCCAAAGTTTAATCCGTCTGGCTTCGTGAACGCATATATATCGTTCCCACTTCGTGACAAC
CCCTTGTTGGATCCAAGTCTCCCGCCCTCAGCCGCCTCAACGAGCTCCCTCAAATCAGATGATGAAACTCCAGAT
ACTAATATCATCATGATTTGTATCAGCGGCAGCGGAGATTTCGACTACGTCAAAACTTGGTGTGACGTTGCGACG
AAAAAACTTGTTACCGATGGATCCTTACACGCGTTGGCCAAAACCATTCTATCACATCAATGTGTTTATACAGTC
ACCGAAGTTGGCGTCCCTGGGCTCCGGCACTTCGTATACAAGTCCCGTGCACAAGTTCAGATCACCTTGCCCGTT
TTCGAAGACCCATATAATGGCGCCAACGAGAAACGAAGACTGGTTACCTTGTATCAGCTATTGCATGATGCGATC
CATGCGAAGTCTGGCCAGTCAGAGCCTCTGAAACTTCAGTATATTCGTACGGATACCGAAAGTGTGATGGGCTGG
ATCACTCAACCATTCGAACTTTATGTTGCGGTTTCTCCGCTACTGCCTAAAAGCGCCATAATAGGAGCTGCAAAC
GCAGTTGTACGATGGGTGAAGAAAGAGGAATCTAGGTTATTCTTGCGCGATGCACCAGAACATTTCGCCGTCCCA
GTTCGTGAAGAAGTTGTTGACCTGGATCACGTGGCCCAAGATTTGCGGACGCCGGACCACGTTCTTCATTCCATC
GTCATGCTGGCTGGCTTGGGCTCCTTTGCTCGAATTTGCGTGTCTGCACCAAAGTTCACGCGTACATTAGTCGAC
AAGTCTGCCCTACGCTCTGTCCCGAAACCCCGCATCTTTCCCAAACAAGTTGGAAAATTCGTTCTGCCACTAGAT
GTTTCAACTCCCCGGGAGTTCCTCAAAGCCATAGGACGTTCATCGGAAAAACAGTTGCAGCCTGAGTCATGGGAT
GCTCTTTGGAAGATGTCGGGGAAGGATATGCGAGAAGCTGGTATAGCGGTCAGGGATCGAAGGTATATTCTATGG
TGTATGGAGAAATATCGACAAGGTCTTGACCCGCGAGATTTCGCTCATGAGCCAAAGCCCAAGAAGACTGTGAGG
GGTTGGGGTCCTTCGGTCCAGAATGGCAAACGAATACGTTCGAGGCGGGTGAAACAACGTTCGAAGCGGTCAAAA
TAG
Gene >AgabiH97|102270
ATGTCACATACCCCTCGCTCCCGGACAGTCTCTCGTCCAACCCCGCCCAGCCTTGGCGCTCACATTGCTTCTCCT
CCCCGCCTTGTCATTCCTCCTTTGCGACCCTCCCCTTCACTTTCAAGCCTGCATATCCACAGTCACGGCACGCCG
ACACCCAATGAGCCCGAGGTCCCTCCTGTTCCTTACCCTCAACGAGACCAAGTTTTGGAGAGCTCAGCTTCGTCT
GTCGTGAACGTGGAAACCAATGAAGGCATATGGATTCAGGACATGGATACCGACACTGACATTACTGAGGAAGAC
CCTTTTGAAGCCGCACGCCCGGTTGCAGCAACAAACGAGGAGTCTAAGAAATTTCTGCGAGATCAGCTAAGGAAA
ACCCTTTCGGACCAGCAAGGTGAGAGGCTTTCGTGATAACGTGCCTGCATTTTCTAACCCAAGTCAAAAAGGACA
TAGATCGCCTGTTCTCAGGTCCAAGAAGCTACATCCCGATCTTCAGGAACTGGCATATGGGGGTGGTGGGTAACA
TCGCCTTCATGTCCCCTCGCCTTCTGAATATCTGTCTCACTAGTTGCTCGGTTTTTACCCCGAGAGTATTACGTG
CTCACCGATGCTGGGAAGCCCGTATTCATAAGGTACTCTTTATCCTTCTGTGGTGAGAATGTGTAGCAATGATTG
TAGTCGGCCAGGGGGTTCTAACTCGGATGGCATGGTATCAACCATCGGCATAATGCAAGCTCTTATATCCGTCTT
CATCGATGATGGTGACAAGATACGATGTATAAATGCTGGACAGTCGAGGATCACCTTTCTATTGCGCCCTCCTCT
TTACTATGTTTGCGTTTCGTCATGGGGTGAACCTGAATCTGTCGTGAGTTCACATATAAAACCATTGCTAGTGTC
ATCATCTTGATTCTGGAATGGCTCAGACTAGAACTCACCTGGAATACTTACACCTCCAAATCTTAAGCATTGTGA
CTGCTTCGCAATTAAGGAGAATATTCGAACGGAGGACTAATTTCGACCTACGACGCTTGCTTGATGGTTCTTGAC
CCCCTCTTTTTTAATGTAACTCACTGACCTCTATTTGTTCAGGTGCTGAAACATTCCTTACGACATTACTTGACG
AACTCGAATTTGATCTAGCCATCAGCTCCTCCTCTCTGCATTGTCTCAAATTAGAACCAAGCCTAAGGAAGAAGA
TCGCGGATTCATTGGTGCCAACTGGCAAAGTCAAAGTGGGTCCTGTCGCCTTCTCGCATTCACTCCATCTATTTA
ACCACCATCTAGGACTTACTTTACGTCATGCTCATGGCTGGAGGTCGCGTCGTCACTCTCATTCGGCCAAGGAAG
CACTCCGTTCACCCTGCAGGTAGGCACTTCAGCACATGCAGCTATCCTCGGCGAACGCCTTTTAGATGTCCATAT
TCTCTTGAACACGGTCAATTCTCCTTCTATATGTAATTCACAGGCATCGGCCTCTTGGATCCCCGTTTGTCTTCC
AAAGTTTAATCCGTCTGGCTTCGTGAACGCATATATATCGTTCCCACTTCGTGACAACCCCTTGTTGGATCCAAG
TCTCCCGCCCTCAGCCGCCTCAACGAGCTCCCTCAAATCAGATGATGAAACTCCAGATACTAATATCATCATGAT
TTGTATCAGCGGCAGCGGAGATTTCGACTACGTCAAAACTTGGTGTGACGTTGCGACGAAAGTAGGTCCTCGTTT
TTTTTTTTTACGTGATTACCACCTTCTAAGAACTACAGAAACTTGTTACCGATGGATCCTTACACGCGTTGGCCA
AAACCATTCTATCACATCAATGTGTTTATACAGTCACCGAAGTTGGCGTCCCTGGGCTCCGGCACTTCGTATACA
AGTCCCGTGCACAAGTTCAGATCACCTTGCCCGTTTTCGAAGACCCATATAATGGCGCCAACGAGAAACGAAGGT
CAGAACGCTGAACTTTTTTAGGGCGCATTTAAACTCATGGTCAGGCTTATAGACTGGTTACCTTGTATCAGCTAT
TGCATGATGCGATCCATGCGAAGTCTGGCCAGTCAGAGCCTCTGAAACTTCAGTATATTCGTACGGATACCGAAA
GTGTGATGGGCTGGGTAAATTTGCCTACTTGATGCCCTTTCTATTGTTGATCTCGTCACAGATCACTCAACCATT
CGAACTTTATGTTGCGGTTTCTCCGCTACTGCCTAAAAGCGCCATAATAGGAGCTGCAAACGCAGTTGTACGATG
GGTGAAGAAAGAGGAATCTAGGTTATTCTTGCGCGATGCACCAGTATTTTGATATATGTATATCTGTGTCGTGAG
CTTTTCGTGAATGTGAATTTAAGAACATTTCAGGAACATTTCGCCGTCCCAGTTCGTGAAGAAGTTGTTGACCTG
GATCACGTGGCCCAAGATTTGCGGACGCCGGACCACGTTCTTCATTCCATCGTCATGCTGGCTGGCTTGGGCTCC
TTTGCTCGAATTTGCGTGTCTGCACCAAAGTTCACGCGTACATTAGTCGACAAGTCTGCCCTACGCTCTGTCCCG
AAACCCCGCATCTTTCCCAAACAAGTTGGAAAATTCGTTCTGCCACTAGATGTTTCAACTCCCCGGGAGTTCCTC
AAAGCCATAGGACGTTCATCGGAAAAACAGTTGCAGCCTGAGTCATGGGATGCTCTTTGGAAGATGTCGGGGAAG
GATATGCGAGAAGCTGGTATAGCGGTCAGGGATCGAAGGTCTGTTACTTCCTTCTGTAATTTTCATGTCCAATTC
TGACAGAAGAATCTATTAGGTATATTCTATGGTGTATGGAGAAATATCGACAAGGTCTTGACCCGCGAGATTTCG
CTCATGAGCCAAAGCCCAAGAAGACTGTGAGGGGGTACGTCGTTTTTTTTTCCGTTCAATCTACCGAGTTCTATT
TATATACCTACTTCCTCCGCTAGTTGGGGTCCTTCGGTCCAGAATGGCAAACGAATACGTTCGAGGCGGGTGAAA
CAACGTTCGAAGCGGTCAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail