Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102240
Gene name
Locationscaffold_7:1291549..1293215
Strand-
Gene length (bp)1666
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 1.4E-43 28 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZW5|ABNA_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnA PE=3 SV=1 3 309 1.0E-67
sp|Q4WYX7|ABNA_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnA PE=3 SV=1 3 309 1.0E-67
sp|A1CLG4|ABNA_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnA PE=3 SV=1 3 309 9.0E-67
sp|A2QT85|ABNA_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnA PE=3 SV=1 2 309 2.0E-64
sp|P42256|ABNA_ASPNG Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger GN=abnA PE=1 SV=1 4 309 7.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZW5|ABNA_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnA PE=3 SV=1 3 309 1.0E-67
sp|Q4WYX7|ABNA_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnA PE=3 SV=1 3 309 1.0E-67
sp|A1CLG4|ABNA_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnA PE=3 SV=1 3 309 9.0E-67
sp|A2QT85|ABNA_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnA PE=3 SV=1 2 309 2.0E-64
sp|P42256|ABNA_ASPNG Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger GN=abnA PE=1 SV=1 4 309 7.0E-64
sp|A1D5W1|ABNA_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnA PE=3 SV=1 3 309 3.0E-63
sp|Q0CS14|ABNA_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnA PE=3 SV=1 1 309 6.0E-62
sp|Q2U8C6|ABNA_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnA PE=3 SV=1 1 309 2.0E-61
sp|B8NDL1|ABNA_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnA PE=3 SV=1 1 309 2.0E-61
sp|Q9HFS9|ABNA_ASPAC Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus aculeatus GN=abnA PE=1 SV=1 4 309 2.0E-60
sp|P94522|EABN1_BACSU Extracellular endo-alpha-(1->5)-L-arabinanase 1 OS=Bacillus subtilis (strain 168) GN=abnA PE=1 SV=3 28 307 3.0E-60
sp|Q93HT9|IABN_GEOTD Intracellular endo-alpha-(1->5)-L-arabinanase OS=Geobacillus thermodenitrificans GN=abn-ts PE=1 SV=1 25 288 5.0E-59
sp|Q5BA96|ABNA_EMENI Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnA PE=3 SV=2 8 309 2.0E-57
sp|B3EYM8|IABN_GEOSE Intracellular endo-alpha-(1->5)-L-arabinanase OS=Geobacillus stearothermophilus GN=abnB PE=1 SV=1 25 288 2.0E-57
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 18 309 6.0E-52
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 18 309 6.0E-52
sp|A1DKY5|ABNC_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnC PE=3 SV=1 4 309 4.0E-50
sp|B0YDT3|ABNC_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnC PE=3 SV=2 4 309 6.0E-50
sp|Q4W930|ABNC_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnC PE=3 SV=2 4 309 3.0E-49
sp|A1CN18|ABNC_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnC PE=3 SV=1 4 309 6.0E-49
sp|P95470|ARBA_CELJU Extracellular exo-alpha-(1->5)-L-arabinofuranosidase ArbA OS=Cellvibrio japonicus (strain Ueda107) GN=arbA PE=1 SV=1 31 309 2.0E-45
sp|A5AAG2|ABNC_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnC PE=3 SV=1 4 309 6.0E-43
sp|Q5AZC8|ABNB_EMENI Arabinan endo-1,5-alpha-L-arabinosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnB PE=2 SV=1 32 310 9.0E-42
sp|B8N803|ABNB_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnB PE=3 SV=2 1 309 3.0E-40
sp|Q0CRJ6|ABNC_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnC PE=3 SV=1 9 309 5.0E-39
sp|Q5AUM3|ABNC_EMENI Arabinan endo-1,5-alpha-L-arabinosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnC PE=2 SV=1 22 309 3.0E-38
sp|Q0CY27|ABNB_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnB PE=3 SV=2 22 308 1.0E-37
sp|Q2UI74|ABNB_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnB PE=3 SV=1 1 305 2.0E-37
sp|Q4X0A5|ABNB_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnB PE=3 SV=2 22 287 6.0E-33
sp|B0XTS5|ABNB_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnB PE=3 SV=2 22 287 1.0E-32
sp|A1DHW8|ABNB_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnB PE=3 SV=2 22 287 2.0E-32
sp|Q5B8T6|ABND_EMENI Probable arabinan endo-1,5-alpha-L-arabinosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnD PE=2 SV=2 26 308 1.0E-28
sp|A5IKD4|EABN_THEP1 Extracellular endo-alpha-(1->5)-L-arabinanase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0637 PE=1 SV=1 1 257 2.0E-15
sp|P42293|EABN2_BACSU Extracellular endo-alpha-(1->5)-L-arabinanase 2 OS=Bacillus subtilis (strain 168) GN=abn2 PE=1 SV=2 2 275 2.0E-11
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 33 310 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102240
MRSLFVLALLSFASLGYAVVGPGVVTGNTAVHDPTMCKDNSGKYFVFSTGTGIEIRTSTDRTAWTFAGRVWPNGA
PWTDKYTLTSNGAIWAPDCTYINGQFWLYYSASSFGSQNSAIFLAKSSTGAPGSWSHEGMVTSSSPSNNYNAIDP
NLLIDGGRWFLSLGSFWTGIKSMNINPSNGFLADTRVTALSQRTANSGAIEASVIFKFNNSYYLFTSWDNCCRGT
SSTYNIRVGRSNSPTGGFVDQNGVALTNGGGTLVLGSHDNIVGPGGQDIMLDGDGPILIYHYYTPSGSFLGINRL
DFSSGWPVVV*
Coding >AgabiH97|102240
ATGCGCTCTCTTTTTGTGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTCTACTGGG
ACGGGGATCGAGATCAGAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCA
CCTTGGACAGACAAATATACACTCACTTCCAATGGTGCGATATGGGCCCCGGATTGTACCTACATTAATGGACAG
TTCTGGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATTCGGCTATCTTCCTTGCCAAGTCTTCCACTGGT
GCTCCCGGCAGTTGGAGCCACGAAGGCATGGTGACTTCTTCGTCCCCTTCCAATAACTATAATGCCATTGATCCC
AATCTCTTGATCGATGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAATATA
AACCCATCCAATGGTTTCCTCGCAGATACCAGAGTCACCGCTCTTTCTCAACGTACAGCAAACAGTGGTGCCATC
GAAGCCAGCGTCATTTTCAAATTCAACAACTCTTATTATCTCTTCACAAGTTGGGATAACTGCTGCAGAGGCACT
TCTAGTACTTACAACATACGTGTCGGACGCTCTAACTCGCCTACTGGTGGGTTTGTCGATCAAAATGGAGTAGCT
CTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGATAACATCGTCGGTCCCGGTGGCCAAGACATCATG
CTCGATGGCGACGGTCCGATTCTGATCTACCATTATTATACACCTTCTGGTAGCTTCCTTGGAATCAACAGGCTC
GATTTCTCCAGTGGCTGGCCCGTCGTTGTCTGA
Transcript >AgabiH97|102240
ATGCGCTCTCTTTTTGTGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTCTACTGGG
ACGGGGATCGAGATCAGAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCA
CCTTGGACAGACAAATATACACTCACTTCCAATGGTGCGATATGGGCCCCGGATTGTACCTACATTAATGGACAG
TTCTGGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATTCGGCTATCTTCCTTGCCAAGTCTTCCACTGGT
GCTCCCGGCAGTTGGAGCCACGAAGGCATGGTGACTTCTTCGTCCCCTTCCAATAACTATAATGCCATTGATCCC
AATCTCTTGATCGATGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAATATA
AACCCATCCAATGGTTTCCTCGCAGATACCAGAGTCACCGCTCTTTCTCAACGTACAGCAAACAGTGGTGCCATC
GAAGCCAGCGTCATTTTCAAATTCAACAACTCTTATTATCTCTTCACAAGTTGGGATAACTGCTGCAGAGGCACT
TCTAGTACTTACAACATACGTGTCGGACGCTCTAACTCGCCTACTGGTGGGTTTGTCGATCAAAATGGAGTAGCT
CTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGATAACATCGTCGGTCCCGGTGGCCAAGACATCATG
CTCGATGGCGACGGTCCGATTCTGATCTACCATTATTATACACCTTCTGGTAGCTTCCTTGGAATCAACAGGCTC
GATTTCTCCAGTGGCTGGCCCGTCGTTGTCTGA
Gene >AgabiH97|102240
ATGCGCTCTCTTTTTGTGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTGTGCGTCC
GTTTGGAAGGATCCTGCTTTTGAAGGAGTAATCTCATTAATTAATTTCAAGCTACTGGGACGGGGATCGAGATCA
GAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCACCTTGGACAGACAAAT
ATACACTCACTTCCAATGGGTATGTTGGCAGAGGTAGTAATTACTTCTCTGACGCACCTCGAAATTTCTAGTGCG
ATATGGGCCCCGGATTGTACCTACATTAATGGACAGTTCTGGGTAGGTAGACCCAGATGCATCTTTGGAAATACC
AGCTTAATCCTTGCCCAGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATGTAAGCTCGTTCTTCTCTCAG
AATTAAATCTTTCTATATTGTACCCTCGACAGTCGGCTATCTTCCTTGCCAAGTCTTCCACTGGTGCTCCCGGTG
AGTATAAGATCCTGGCATGGGCGAAGTGGAGCTCTCATCCTTTTCGTTTCAGGCAGTTGGAGCCACGAAGGCATG
GTGACTTCTTCGTCCCCTTCCAATAACTATAATGTAAGTGTTCAATTGATAAAGAAACATCTTCTGACAGTTCTT
AGGCCATTGATCCCAAGTACGTGCGGGTTCTATCAAATACAACCAATACTAAGTCACGATTTTGAATTCCATGAA
ATAGTCTCTTGATCGGTGCGTCTTATCAATTGAACCTTGAATCCAGGCTGTTTTTTAAACCGGTTGCTTCATAGA
TGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAAGTTAGTCTCCTCTTTTCT
ATCTTCTTCACAACATCAAGCCTCATTCCTCTTTCAAGTATAAACCCATCCAATGGTTTCCTCGCAGATACCAGA
GTCACCGCTCTTTCTCAACGTACAGCAAACAGTGGTGCCATCGAAGCCAGCGTCATTTTCAAATTCAACAACTCT
TATTATCTCTTCACAAGTTGGGATAACTGCTGCAGAGGCACTTCTAGTACTTACAACATACGTGTCGGACGCTCT
AACTCGTAAGTGTGAAACATTTCCTCCCTCCCTTCCTCTTATTGGATATATGACTGAACATGAGGTTAGGCCTAC
TGGTGGGTTTGTCGATCAAAATGGAGTAGCTCTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGATAA
CGTGAGTTTTCAATCAAAATATTCCAGAATGCTCGAATGACATATACACTGCAATAGATCGTCGGTCCCGGTGGC
CAAGACATCATGCTCGATGGCGACGGTCCGATTCTGATCTACCGTAAGCACTCCATCCCCCATATCTTTCAACTA
CAACTAAGCAAATACATTTCATTATCACACAGATTATTATACACCTTCTGGTAGCTTCGTAAGCAATCTACTCTC
CTTTTTCAAATTAATCGATGACTTGATATCAAACAAATAGCTTGGAATCAACAGGCTCGATTTCTCCAGTGGCTG
GCCCGTCGTTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail