Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102230
Gene name
Locationscaffold_7:1287860..1291305
Strand+
Gene length (bp)3445
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 2.0E-22 480 834
PF00400 WD40 WD domain, G-beta repeat 2.3E-05 49 83
PF00400 WD40 WD domain, G-beta repeat 2.2E-01 214 247
PF00400 WD40 WD domain, G-beta repeat 2.2E-01 334 373
PF07687 M20_dimer Peptidase dimerisation domain 4.5E-11 591 730

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 8 832 3.0E-136
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 413 839 6.0E-72
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 413 839 3.0E-71
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 413 839 1.0E-70
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 413 839 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 8 832 3.0E-136
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 413 839 6.0E-72
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 413 839 3.0E-71
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 413 839 1.0E-70
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 413 839 5.0E-69
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 413 834 1.0E-68
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 413 839 3.0E-68
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 417 839 1.0E-67
sp|Q66HG3|CNDP1_RAT Beta-Ala-His dipeptidase OS=Rattus norvegicus GN=Cndp1 PE=1 SV=1 412 850 2.0E-63
sp|Q96KN2|CNDP1_HUMAN Beta-Ala-His dipeptidase OS=Homo sapiens GN=CNDP1 PE=1 SV=4 412 839 5.0E-63
sp|P43616|DUG1_YEAST Cys-Gly metallodipeptidase DUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG1 PE=1 SV=1 404 834 2.0E-62
sp|Q8BUG2|CNDP1_MOUSE Beta-Ala-His dipeptidase OS=Mus musculus GN=Cndp1 PE=2 SV=1 405 847 3.0E-62
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 10 375 3.0E-14
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 4 375 1.0E-12
sp|Q2L2J6|DAPE_BORA1 Succinyl-diaminopimelate desuccinylase OS=Bordetella avium (strain 197N) GN=dapE PE=3 SV=1 413 550 2.0E-11
sp|A9HKR2|DAPE_GLUDA Succinyl-diaminopimelate desuccinylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapE PE=3 SV=1 415 710 2.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 31 379 5.0E-11
sp|A7ZFC1|DAPE_CAMC1 Succinyl-diaminopimelate desuccinylase OS=Campylobacter concisus (strain 13826) GN=dapE PE=3 SV=1 479 825 6.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 9 377 7.0E-11
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 443 732 9.0E-11
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 443 732 9.0E-11
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 443 732 9.0E-11
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 443 732 9.0E-11
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 443 732 9.0E-11
sp|B5Z008|DAPE_ECO5E Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapE PE=3 SV=1 479 784 5.0E-10
sp|Q8XBE0|DAPE_ECO57 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O157:H7 GN=dapE PE=3 SV=1 479 784 5.0E-10
sp|B2TXP7|DAPE_SHIB3 Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapE PE=3 SV=1 479 784 6.0E-10
sp|Q3YZ81|DAPE_SHISS Succinyl-diaminopimelate desuccinylase OS=Shigella sonnei (strain Ss046) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B7NQK9|DAPE_ECO7I Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|Q0T246|DAPE_SHIF8 Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|P0AED8|DAPE_SHIFL Succinyl-diaminopimelate desuccinylase OS=Shigella flexneri GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|Q31Y20|DAPE_SHIBS Succinyl-diaminopimelate desuccinylase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B1LNC1|DAPE_ECOSM Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|P0AED7|DAPE_ECOLI Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12) GN=dapE PE=1 SV=1 479 784 7.0E-10
sp|B1IWI8|DAPE_ECOLC Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|A8A2W3|DAPE_ECOHS Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O9:H4 (strain HS) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B1XAE3|DAPE_ECODH Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / DH10B) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|C4ZX46|DAPE_ECOBW Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B7M7H2|DAPE_ECO8A Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O8 (strain IAI1) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B7LCK7|DAPE_ECO55 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain 55989 / EAEC) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|B7UGM1|DAPE_ECO27 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|A7ZPR5|DAPE_ECO24 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapE PE=3 SV=1 479 784 7.0E-10
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|Q1R8Q6|DAPE_ECOUT Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain UTI89 / UPEC) GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|B6I539|DAPE_ECOSE Succinyl-diaminopimelate desuccinylase OS=Escherichia coli (strain SE11) GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|Q8FF82|DAPE_ECOL6 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|A1ADX7|DAPE_ECOK1 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O1:K1 / APEC GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|B7MHW4|DAPE_ECO45 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dapE PE=3 SV=1 479 784 8.0E-10
sp|B7N653|DAPE_ECOLU Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dapE PE=3 SV=1 479 784 1.0E-09
sp|B7LKH0|DAPE_ESCF3 Succinyl-diaminopimelate desuccinylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapE PE=3 SV=1 479 784 1.0E-09
sp|Q1RGL3|DAPE_RICBR Succinyl-diaminopimelate desuccinylase OS=Rickettsia bellii (strain RML369-C) GN=dapE PE=3 SV=1 476 839 1.0E-09
sp|Q32D98|DAPE_SHIDS Succinyl-diaminopimelate desuccinylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapE PE=3 SV=1 479 784 2.0E-09
sp|A8GYC8|DAPE_RICB8 Succinyl-diaminopimelate desuccinylase OS=Rickettsia bellii (strain OSU 85-389) GN=dapE PE=3 SV=1 476 839 2.0E-09
sp|Q2GHW1|DAPE_EHRCR Succinyl-diaminopimelate desuccinylase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dapE PE=3 SV=1 438 839 3.0E-09
sp|A0L3N2|DAPE_MAGMM Succinyl-diaminopimelate desuccinylase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dapE PE=3 SV=2 439 834 3.0E-09
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 468 630 4.0E-09
sp|Q0TF05|DAPE_ECOL5 Succinyl-diaminopimelate desuccinylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dapE PE=3 SV=1 479 784 4.0E-09
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 220 375 4.0E-09
sp|Q3J9B0|DAPE_NITOC Succinyl-diaminopimelate desuccinylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapE PE=3 SV=1 433 630 6.0E-09
sp|Q2GAU5|DAPE_NOVAD Succinyl-diaminopimelate desuccinylase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dapE PE=3 SV=1 420 557 8.0E-09
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 438 744 1.0E-08
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 438 744 1.0E-08
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 476 602 3.0E-08
sp|B5XVN4|DAPE_KLEP3 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae (strain 342) GN=dapE PE=3 SV=1 479 752 4.0E-08
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 204 374 4.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 218 379 5.0E-08
sp|Q4UJR2|DAPE_RICFE Succinyl-diaminopimelate desuccinylase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dapE PE=3 SV=1 476 837 6.0E-08
sp|A9IR81|DAPE_BORPD Succinyl-diaminopimelate desuccinylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dapE PE=3 SV=1 477 533 6.0E-08
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 225 380 6.0E-08
sp|A7ML10|DAPE_CROS8 Succinyl-diaminopimelate desuccinylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapE PE=3 SV=1 479 784 7.0E-08
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 9 116 7.0E-08
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 9 116 7.0E-08
sp|A1TQ19|DAPE_ACIAC Succinyl-diaminopimelate desuccinylase OS=Acidovorax citrulli (strain AAC00-1) GN=dapE PE=3 SV=1 479 602 9.0E-08
sp|Q7VF72|DAPE_HELHP Succinyl-diaminopimelate desuccinylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dapE PE=3 SV=1 481 602 1.0E-07
sp|Q7W8Y3|DAPE_BORPA Succinyl-diaminopimelate desuccinylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dapE PE=3 SV=1 477 533 1.0E-07
sp|Q7WKC6|DAPE_BORBR Succinyl-diaminopimelate desuccinylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dapE PE=3 SV=1 477 533 1.0E-07
sp|Q7VXJ5|DAPE_BORPE Succinyl-diaminopimelate desuccinylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dapE PE=3 SV=1 477 533 1.0E-07
sp|B4SQ35|DAPE_STRM5 Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain R551-3) GN=dapE PE=3 SV=1 439 771 1.0E-07
sp|A8ADB6|DAPE_CITK8 Succinyl-diaminopimelate desuccinylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dapE PE=3 SV=1 479 784 1.0E-07
sp|A6TC94|DAPE_KLEP7 Succinyl-diaminopimelate desuccinylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|A8F095|DAPE_RICCK Succinyl-diaminopimelate desuccinylase OS=Rickettsia canadensis (strain McKiel) GN=dapE PE=3 SV=1 476 837 2.0E-07
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 2 99 2.0E-07
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 479 602 2.0E-07
sp|Q8Z4S2|DAPE_SALTI Succinyl-diaminopimelate desuccinylase OS=Salmonella typhi GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 477 744 2.0E-07
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 438 744 2.0E-07
sp|B5BB22|DAPE_SALPK Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|C0PYS5|DAPE_SALPC Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi C (strain RKS4594) GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|Q5PLR5|DAPE_SALPA Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|Q57LM8|DAPE_SALCH Succinyl-diaminopimelate desuccinylase OS=Salmonella choleraesuis (strain SC-B67) GN=dapE PE=3 SV=1 479 784 2.0E-07
sp|B9KD35|DAPE_CAMLR Succinyl-diaminopimelate desuccinylase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dapE PE=3 SV=1 479 825 3.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 215 383 3.0E-07
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 9 99 3.0E-07
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 438 744 3.0E-07
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 409 524 3.0E-07
sp|Q8ZN75|DAPE_SALTY Succinyl-diaminopimelate desuccinylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapE PE=1 SV=1 479 784 3.0E-07
sp|B4TR55|DAPE_SALSV Succinyl-diaminopimelate desuccinylase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|A9N2Z9|DAPE_SALPB Succinyl-diaminopimelate desuccinylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|B4T0L0|DAPE_SALNS Succinyl-diaminopimelate desuccinylase OS=Salmonella newport (strain SL254) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|B4TD58|DAPE_SALHS Succinyl-diaminopimelate desuccinylase OS=Salmonella heidelberg (strain SL476) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|B5RCV3|DAPE_SALG2 Succinyl-diaminopimelate desuccinylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|B5R4J0|DAPE_SALEP Succinyl-diaminopimelate desuccinylase OS=Salmonella enteritidis PT4 (strain P125109) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|B5FQH3|DAPE_SALDC Succinyl-diaminopimelate desuccinylase OS=Salmonella dublin (strain CT_02021853) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|A9MHQ8|DAPE_SALAR Succinyl-diaminopimelate desuccinylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapE PE=3 SV=1 479 784 3.0E-07
sp|Q5FFA0|DAPE_EHRRG Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Gardel) GN=dapE PE=3 SV=1 438 632 3.0E-07
sp|Q3YT10|DAPE_EHRCJ Succinyl-diaminopimelate desuccinylase OS=Ehrlichia canis (strain Jake) GN=dapE PE=3 SV=2 477 839 3.0E-07
sp|Q5HC82|DAPE_EHRRW Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Welgevonden) GN=dapE PE=3 SV=1 438 632 4.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 188 375 4.0E-07
sp|Q5P9A2|DAPE_ANAMM Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain St. Maries) GN=dapE PE=3 SV=2 438 634 4.0E-07
sp|B9KHC9|DAPE_ANAMF Succinyl-diaminopimelate desuccinylase OS=Anaplasma marginale (strain Florida) GN=dapE PE=3 SV=2 438 634 4.0E-07
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 9 99 4.0E-07
sp|Q5FPX5|DAPE_GLUOX Succinyl-diaminopimelate desuccinylase OS=Gluconobacter oxydans (strain 621H) GN=dapE PE=3 SV=2 474 557 5.0E-07
sp|B5ES53|DAPE_ACIF5 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dapE PE=3 SV=1 477 550 5.0E-07
sp|B7JBS5|DAPE_ACIF2 Succinyl-diaminopimelate desuccinylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dapE PE=3 SV=1 477 550 5.0E-07
sp|Q2SBP0|DAPE_HAHCH Succinyl-diaminopimelate desuccinylase OS=Hahella chejuensis (strain KCTC 2396) GN=dapE PE=3 SV=1 405 624 5.0E-07
sp|Q07TX3|DAPE_RHOP5 Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisA53) GN=dapE PE=3 SV=1 477 632 5.0E-07
sp|B4RSS7|DAPE2_ALTMD Succinyl-diaminopimelate desuccinylase 2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dapE2 PE=3 SV=1 471 602 5.0E-07
sp|Q8PAU0|DAPE_XANCP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dapE PE=3 SV=2 477 729 5.0E-07
sp|B0RW53|DAPE_XANCB Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=dapE PE=3 SV=1 477 729 5.0E-07
sp|Q4USS4|DAPE_XANC8 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dapE PE=3 SV=2 477 729 5.0E-07
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 479 602 6.0E-07
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 479 602 6.0E-07
sp|A6SZR5|DAPE_JANMA Succinyl-diaminopimelate desuccinylase OS=Janthinobacterium sp. (strain Marseille) GN=dapE PE=3 SV=1 476 550 6.0E-07
sp|Q2W0E7|DAPE_MAGSA Succinyl-diaminopimelate desuccinylase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dapE PE=3 SV=1 477 602 6.0E-07
sp|A7I005|DAPE_CAMHC Succinyl-diaminopimelate desuccinylase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dapE PE=3 SV=1 470 630 7.0E-07
sp|Q87F49|DAPE_XYLFT Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dapE PE=3 SV=1 477 567 7.0E-07
sp|B2I6B4|DAPE_XYLF2 Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain M23) GN=dapE PE=3 SV=1 477 567 7.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 215 382 7.0E-07
sp|Q5NM04|DAPE_ZYMMO Succinyl-diaminopimelate desuccinylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dapE PE=3 SV=1 477 556 7.0E-07
sp|Q8CQC2|DAPE_STAES Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapE PE=3 SV=1 438 715 8.0E-07
sp|Q5HKI1|DAPE_STAEQ Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapE PE=3 SV=1 438 715 8.0E-07
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 8 94 9.0E-07
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 7 134 9.0E-07
sp|Q6G567|DAPE_BARHE Succinyl-diaminopimelate desuccinylase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dapE PE=3 SV=1 471 602 1.0E-06
sp|A2SGS4|DAPE_METPP Succinyl-diaminopimelate desuccinylase OS=Methylibium petroleiphilum (strain PM1) GN=dapE PE=3 SV=1 468 602 1.0E-06
sp|Q9K9G9|FAPD_BACHD N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine deformylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ylmB PE=1 SV=1 389 727 1.0E-06
sp|Q3BVJ3|DAPE_XANC5 Succinyl-diaminopimelate desuccinylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dapE PE=3 SV=1 477 836 1.0E-06
sp|B2FIC0|DAPE_STRMK Succinyl-diaminopimelate desuccinylase OS=Stenotrophomonas maltophilia (strain K279a) GN=dapE PE=3 SV=1 477 771 1.0E-06
sp|B2SQY5|DAPE_XANOP Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dapE PE=3 SV=1 477 550 1.0E-06
sp|Q7N3J4|DAPE_PHOLL Succinyl-diaminopimelate desuccinylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dapE PE=3 SV=1 477 834 1.0E-06
sp|Q5H1C8|DAPE_XANOR Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dapE PE=3 SV=2 477 550 1.0E-06
sp|Q2P492|DAPE_XANOM Succinyl-diaminopimelate desuccinylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dapE PE=3 SV=1 477 550 1.0E-06
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 439 847 1.0E-06
sp|Q9PH30|DAPE_XYLFA Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain 9a5c) GN=dapE PE=3 SV=1 477 567 1.0E-06
sp|Q5WY21|DAPE_LEGPL Succinyl-diaminopimelate desuccinylase OS=Legionella pneumophila (strain Lens) GN=dapE PE=3 SV=1 413 550 1.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 216 375 2.0E-06
sp|B4RDU4|DAPE_PHEZH Succinyl-diaminopimelate desuccinylase OS=Phenylobacterium zucineum (strain HLK1) GN=dapE PE=3 SV=1 476 784 2.0E-06
sp|B1Y6E7|DAPE_LEPCP Succinyl-diaminopimelate desuccinylase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dapE PE=3 SV=1 470 602 2.0E-06
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 480 583 2.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 470 602 2.0E-06
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 218 375 2.0E-06
sp|Q0BE03|DAPE_BURCM Succinyl-diaminopimelate desuccinylase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dapE PE=3 SV=1 470 602 2.0E-06
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 218 375 2.0E-06
sp|Q2N7X8|DAPE_ERYLH Succinyl-diaminopimelate desuccinylase OS=Erythrobacter litoralis (strain HTCC2594) GN=dapE PE=3 SV=1 416 710 2.0E-06
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 477 632 2.0E-06
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 15 110 2.0E-06
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 10 88 2.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 225 380 2.0E-06
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 221 375 2.0E-06
sp|A4SYV9|DAPE_POLSQ Succinyl-diaminopimelate desuccinylase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapE PE=3 SV=1 468 602 2.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 215 380 3.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 225 380 3.0E-06
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 420 550 3.0E-06
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 477 602 3.0E-06
sp|A5IG28|DAPE_LEGPC Succinyl-diaminopimelate desuccinylase OS=Legionella pneumophila (strain Corby) GN=dapE PE=3 SV=1 413 550 3.0E-06
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 479 602 3.0E-06
sp|Q8DBA6|DAPE_VIBVU Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain CMCP6) GN=dapE PE=3 SV=1 477 602 3.0E-06
sp|Q7MIL6|DAPE_VIBVY Succinyl-diaminopimelate desuccinylase OS=Vibrio vulnificus (strain YJ016) GN=dapE PE=3 SV=2 477 602 4.0E-06
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 477 564 4.0E-06
sp|B2US41|DAPE_HELPS Succinyl-diaminopimelate desuccinylase OS=Helicobacter pylori (strain Shi470) GN=dapE PE=3 SV=1 433 628 4.0E-06
sp|A5FYQ7|DAPE_ACICJ Succinyl-diaminopimelate desuccinylase OS=Acidiphilium cryptum (strain JF-5) GN=dapE PE=3 SV=1 439 710 4.0E-06
sp|Q1GMM6|DAPE2_RUEST Succinyl-diaminopimelate desuccinylase 2 OS=Ruegeria sp. (strain TM1040) GN=dapE2 PE=3 SV=1 481 834 4.0E-06
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 14 90 4.0E-06
sp|Q5F812|DAPE_NEIG1 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapE PE=3 SV=1 416 606 4.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 14 90 4.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 14 126 4.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 14 90 4.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 224 379 4.0E-06
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 47 375 5.0E-06
sp|Q0ADY0|DAPE_NITEC Succinyl-diaminopimelate desuccinylase OS=Nitrosomonas eutropha (strain C91) GN=dapE PE=3 SV=1 477 532 5.0E-06
sp|B1YSH9|DAPE_BURA4 Succinyl-diaminopimelate desuccinylase OS=Burkholderia ambifaria (strain MC40-6) GN=dapE PE=3 SV=1 470 602 5.0E-06
sp|B2T5K8|DAPE_BURPP Succinyl-diaminopimelate desuccinylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dapE PE=3 SV=1 479 630 5.0E-06
sp|A0K8F6|DAPE_BURCH Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain HI2424) GN=dapE PE=3 SV=1 470 602 5.0E-06
sp|Q1BHJ5|DAPE_BURCA Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain AU 1054) GN=dapE PE=3 SV=1 470 602 5.0E-06
sp|Q9JYL2|DAPE_NEIMB Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapE PE=1 SV=1 416 606 5.0E-06
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 467 534 6.0E-06
sp|A1KUW7|DAPE_NEIMF Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapE PE=3 SV=1 416 606 6.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 220 375 6.0E-06
sp|Q0KA02|DAPE_CUPNH Succinyl-diaminopimelate desuccinylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dapE PE=3 SV=1 479 550 6.0E-06
sp|Q30QK9|DAPE_SULDN Succinyl-diaminopimelate desuccinylase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dapE PE=3 SV=1 481 602 6.0E-06
sp|A7GX37|DAPE_CAMC5 Succinyl-diaminopimelate desuccinylase OS=Campylobacter curvus (strain 525.92) GN=dapE PE=3 SV=1 464 632 6.0E-06
sp|Q470C3|DAPE_CUPPJ Succinyl-diaminopimelate desuccinylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dapE PE=3 SV=1 479 602 7.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 230 375 8.0E-06
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 234 377 8.0E-06
sp|A4G4Q7|DAPE_HERAR Succinyl-diaminopimelate desuccinylase OS=Herminiimonas arsenicoxydans GN=dapE PE=3 SV=1 476 550 8.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 214 375 8.0E-06
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 230 377 8.0E-06
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 9 94 9.0E-06
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 225 380 9.0E-06
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 467 550 9.0E-06
sp|B4RKY8|DAPE_NEIG2 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=dapE PE=3 SV=2 416 606 9.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 10 83 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102230
MGDASPFLLHSLQHNKSSVLSLAATDKFIFSGSQTGDILVWDKQTFSLKNTLRGHTGSVLALEIAKDKAWLFSSS
GDSTVRVWCTKSLSPLYVIVPYLETCSGDLFSLAWSSTRQVLFVGCQNTSLQWISFRSPSTSSPPAESTSSGKTT
PTHTSRQAHKFFDSYPIYQRRPADVHAFNVLPRLHGRDTPDLDQADITPPQAYFSIPACNVIDSAHWGYIYCMAI
LDDEDGVRLATGSGDEVVKLWDCSADRPNLIHQFSCEHGAVLSLVAKGDIIAAGCQDGYVKVLDLETKTAIRTII
VQEGVDILSLSIFDQDLFSCSADGRVKRWSSAFDCIAEWDAHTNIVLSSVVTQFPTGGICLTTGGSDSQIKVWEV
FTPKVGQQSLQNRFSSSSTQQLTGSVPRNLVETLFYTLYNFVAIPSVSSQLKHREDCRQAGVWLKKYLSQLGAQA
TLLPTGEGGNPIVLGTFEGRKSDKPKPRILFYGHYDVISAPPEGWDSDPFVLTGKNGYLYGRGVTDDKGPIIAVA
CAAADLIAQRALGVDLVFLVEGEEEVGSARFNETVRKYKDSIGHIDEILVSNSTWIAEDRACLTYGSRGVIHCSM
VISNDKPDLHSGIEGGVTVEPMTDMVHLLAKLRDCSGRILVPGFYDCVQPATKEEEELYQLLSDVTCKPASHLRS
RWCEPSLTIHNIEISGPKNATIIPSKVKAQISLRIVPNQDLEVIVASVVSFLKKTFDGFESPNKLQVDVQHTANW
WLGEVDYDPYFKALENAVAKEWDMEPLRIREGGSIPSVPWLEKEFKCHALHLPMGQSSDQAHLPNERISLLNLQK
GKAVVEKFLIEVANEGFISQIPKDA*
Coding >AgabiH97|102230
ATGGGCGACGCATCCCCGTTCCTCCTCCACTCGCTCCAGCACAACAAGAGCTCCGTTCTCAGCTTGGCCGCAACC
GACAAGTTCATCTTTTCTGGAAGCCAAACTGGCGACATCCTCGTATGGGATAAGCAGACTTTCTCTCTCAAGAAC
ACCCTCCGTGGCCACACCGGCAGCGTCCTGGCCTTGGAGATCGCCAAAGACAAAGCATGGCTCTTCAGCTCTAGC
GGCGATAGTACAGTTCGGGTCTGGTGTACCAAATCCTTGTCGCCACTCTATGTGATCGTGCCTTATCTCGAGACA
TGCTCCGGCGACTTGTTCTCCCTTGCTTGGTCTTCAACCCGCCAGGTTTTGTTTGTGGGTTGTCAGAACACTTCA
CTCCAGTGGATCAGCTTCCGTTCACCATCAACATCGTCTCCTCCGGCAGAATCTACGTCGAGTGGAAAAACCACT
CCCACCCATACATCCCGCCAAGCACACAAGTTCTTCGATAGCTATCCAATATATCAACGCAGACCTGCCGATGTC
CATGCTTTCAATGTACTGCCCCGTCTCCATGGCCGCGATACACCAGACTTAGATCAAGCAGATATCACGCCTCCC
CAGGCCTATTTTAGTATACCCGCATGCAACGTTATCGATTCCGCGCATTGGGGCTACATCTACTGTATGGCTATT
CTCGACGACGAGGACGGCGTCCGACTTGCAACCGGTAGTGGAGACGAGGTTGTTAAACTCTGGGATTGTTCAGCA
GATCGTCCAAACCTGATCCACCAATTTTCATGTGAGCATGGGGCGGTTCTATCGCTGGTGGCCAAAGGCGACATC
ATTGCTGCTGGCTGTCAGGATGGATATGTCAAGGTGCTTGACCTTGAGACCAAAACGGCCATTCGCACCATCATT
GTTCAAGAGGGTGTTGATATTCTGTCTTTGTCAATTTTTGACCAAGACTTATTCAGTTGCTCCGCCGATGGTCGT
GTCAAGCGCTGGTCTTCAGCTTTCGATTGCATAGCTGAATGGGATGCACATACGAATATCGTACTGTCTTCTGTC
GTAACACAGTTCCCGACCGGTGGAATTTGCCTCACAACTGGTGGCAGTGACTCCCAAATCAAGGTTTGGGAAGTG
TTCACCCCCAAGGTTGGACAACAATCTCTCCAGAACAGATTCAGTTCTTCTTCCACTCAACAACTCACTGGCTCC
GTGCCGCGCAACCTTGTAGAAACCCTGTTTTATACCCTTTACAATTTTGTAGCCATACCAAGTGTGAGCTCACAA
CTGAAGCACAGAGAGGATTGTCGACAAGCCGGTGTGTGGCTGAAAAAGTATCTGTCCCAACTCGGTGCTCAGGCT
ACACTTCTTCCCACCGGTGAAGGTGGCAATCCGATTGTGCTAGGAACGTTCGAGGGTCGGAAGAGTGACAAACCA
AAACCTCGTATTCTCTTCTACGGACACTACGACGTCATTTCAGCTCCTCCAGAAGGCTGGGACTCTGATCCGTTT
GTCCTGACGGGGAAAAATGGATATCTATATGGGCGGGGTGTAACGGACGACAAGGGCCCGATAATTGCTGTCGCA
TGTGCTGCAGCCGATCTCATCGCCCAAAGGGCCCTGGGCGTTGATCTGGTCTTCTTGGTCGAGGGTGAGGAGGAA
GTGGGGAGTGCTCGATTCAACGAGACAGTAAGGAAGTACAAAGACTCGATTGGACACATTGATGAAATTCTTGTT
AGTAATTCCACTTGGATCGCGGAAGATAGAGCTTGTTTGACCTATGGCTCGAGGGGTGTTATCCATTGTAGTATG
GTTATTTCGAACGATAAGCCAGATCTACATTCCGGTATTGAAGGTGGTGTCACAGTGGAACCAATGACCGACATG
GTTCACCTCCTTGCAAAACTTAGAGACTGTAGTGGTCGCATTCTAGTACCTGGCTTCTATGACTGTGTACAACCA
GCCACGAAGGAAGAAGAAGAATTATATCAGTTACTGTCAGACGTGACTTGCAAACCCGCGTCACATTTACGTTCG
AGATGGTGTGAACCGTCCTTGACGATTCATAATATTGAGATAAGTGGGCCTAAGAATGCTACGATCATCCCCAGC
AAGGTCAAAGCTCAAATTTCGTTGCGTATCGTGCCCAATCAGGACCTTGAGGTTATTGTTGCCTCTGTAGTCTCT
TTTCTCAAAAAGACTTTTGACGGTTTCGAGAGTCCAAATAAACTCCAGGTTGATGTCCAACATACAGCGAACTGG
TGGTTGGGCGAAGTCGATTATGACCCTTACTTTAAGGCCTTGGAGAATGCTGTCGCAAAAGAGTGGGATATGGAA
CCATTGCGGATACGAGAGGGTGGTTCTATCCCTTCTGTTCCTTGGCTTGAGAAAGAGTTTAAATGCCATGCGCTG
CACCTGCCTATGGGGCAGAGTTCCGACCAAGCGCATTTACCCAATGAGCGTATATCCCTGCTCAACTTACAAAAA
GGAAAGGCAGTTGTAGAAAAGTTTTTGATTGAGGTTGCAAATGAAGGGTTCATATCCCAGATACCGAAGGATGCG
TAG
Transcript >AgabiH97|102230
ATGGGCGACGCATCCCCGTTCCTCCTCCACTCGCTCCAGCACAACAAGAGCTCCGTTCTCAGCTTGGCCGCAACC
GACAAGTTCATCTTTTCTGGAAGCCAAACTGGCGACATCCTCGTATGGGATAAGCAGACTTTCTCTCTCAAGAAC
ACCCTCCGTGGCCACACCGGCAGCGTCCTGGCCTTGGAGATCGCCAAAGACAAAGCATGGCTCTTCAGCTCTAGC
GGCGATAGTACAGTTCGGGTCTGGTGTACCAAATCCTTGTCGCCACTCTATGTGATCGTGCCTTATCTCGAGACA
TGCTCCGGCGACTTGTTCTCCCTTGCTTGGTCTTCAACCCGCCAGGTTTTGTTTGTGGGTTGTCAGAACACTTCA
CTCCAGTGGATCAGCTTCCGTTCACCATCAACATCGTCTCCTCCGGCAGAATCTACGTCGAGTGGAAAAACCACT
CCCACCCATACATCCCGCCAAGCACACAAGTTCTTCGATAGCTATCCAATATATCAACGCAGACCTGCCGATGTC
CATGCTTTCAATGTACTGCCCCGTCTCCATGGCCGCGATACACCAGACTTAGATCAAGCAGATATCACGCCTCCC
CAGGCCTATTTTAGTATACCCGCATGCAACGTTATCGATTCCGCGCATTGGGGCTACATCTACTGTATGGCTATT
CTCGACGACGAGGACGGCGTCCGACTTGCAACCGGTAGTGGAGACGAGGTTGTTAAACTCTGGGATTGTTCAGCA
GATCGTCCAAACCTGATCCACCAATTTTCATGTGAGCATGGGGCGGTTCTATCGCTGGTGGCCAAAGGCGACATC
ATTGCTGCTGGCTGTCAGGATGGATATGTCAAGGTGCTTGACCTTGAGACCAAAACGGCCATTCGCACCATCATT
GTTCAAGAGGGTGTTGATATTCTGTCTTTGTCAATTTTTGACCAAGACTTATTCAGTTGCTCCGCCGATGGTCGT
GTCAAGCGCTGGTCTTCAGCTTTCGATTGCATAGCTGAATGGGATGCACATACGAATATCGTACTGTCTTCTGTC
GTAACACAGTTCCCGACCGGTGGAATTTGCCTCACAACTGGTGGCAGTGACTCCCAAATCAAGGTTTGGGAAGTG
TTCACCCCCAAGGTTGGACAACAATCTCTCCAGAACAGATTCAGTTCTTCTTCCACTCAACAACTCACTGGCTCC
GTGCCGCGCAACCTTGTAGAAACCCTGTTTTATACCCTTTACAATTTTGTAGCCATACCAAGTGTGAGCTCACAA
CTGAAGCACAGAGAGGATTGTCGACAAGCCGGTGTGTGGCTGAAAAAGTATCTGTCCCAACTCGGTGCTCAGGCT
ACACTTCTTCCCACCGGTGAAGGTGGCAATCCGATTGTGCTAGGAACGTTCGAGGGTCGGAAGAGTGACAAACCA
AAACCTCGTATTCTCTTCTACGGACACTACGACGTCATTTCAGCTCCTCCAGAAGGCTGGGACTCTGATCCGTTT
GTCCTGACGGGGAAAAATGGATATCTATATGGGCGGGGTGTAACGGACGACAAGGGCCCGATAATTGCTGTCGCA
TGTGCTGCAGCCGATCTCATCGCCCAAAGGGCCCTGGGCGTTGATCTGGTCTTCTTGGTCGAGGGTGAGGAGGAA
GTGGGGAGTGCTCGATTCAACGAGACAGTAAGGAAGTACAAAGACTCGATTGGACACATTGATGAAATTCTTGTT
AGTAATTCCACTTGGATCGCGGAAGATAGAGCTTGTTTGACCTATGGCTCGAGGGGTGTTATCCATTGTAGTATG
GTTATTTCGAACGATAAGCCAGATCTACATTCCGGTATTGAAGGTGGTGTCACAGTGGAACCAATGACCGACATG
GTTCACCTCCTTGCAAAACTTAGAGACTGTAGTGGTCGCATTCTAGTACCTGGCTTCTATGACTGTGTACAACCA
GCCACGAAGGAAGAAGAAGAATTATATCAGTTACTGTCAGACGTGACTTGCAAACCCGCGTCACATTTACGTTCG
AGATGGTGTGAACCGTCCTTGACGATTCATAATATTGAGATAAGTGGGCCTAAGAATGCTACGATCATCCCCAGC
AAGGTCAAAGCTCAAATTTCGTTGCGTATCGTGCCCAATCAGGACCTTGAGGTTATTGTTGCCTCTGTAGTCTCT
TTTCTCAAAAAGACTTTTGACGGTTTCGAGAGTCCAAATAAACTCCAGGTTGATGTCCAACATACAGCGAACTGG
TGGTTGGGCGAAGTCGATTATGACCCTTACTTTAAGGCCTTGGAGAATGCTGTCGCAAAAGAGTGGGATATGGAA
CCATTGCGGATACGAGAGGGTGGTTCTATCCCTTCTGTTCCTTGGCTTGAGAAAGAGTTTAAATGCCATGCGCTG
CACCTGCCTATGGGGCAGAGTTCCGACCAAGCGCATTTACCCAATGAGCGTATATCCCTGCTCAACTTACAAAAA
GGAAAGGCAGTTGTAGAAAAGTTTTTGATTGAGGTTGCAAATGAAGGGTTCATATCCCAGATACCGAAGGATGCG
TAG
Gene >AgabiH97|102230
ATGGGCGACGCATCCCCGTTCCTCCTCCACTCGCTCCAGCACAACAAGAGCTCCGTTCTCAGCTTGGCCGCAACC
GACAAGTTCATCTTTTCTGGAAGCCAAACTGGCGACATCCTCGTCCGTGCCCTGCCAGCTTTGCCGCTCCCGTTC
TGACGCTCCCTTCTAGGTATGGGATAAGCAGACTTTCTCTCTCAAGAACACCCTCCGTGGCCACACCGGCAGCGT
CCTGGCCTTGGAGATCGCCAAAGACAAAGCATGGCTCTTCAGCTCTAGCGGTGCGTGCAGCTTCGGCCTCCATCC
TTTTCCCGACTAATACCGCTTTCAGGCGATAGTACAGTTCGGGTATGCATCCTGTCGCCCATCCCATAGTATATG
CTCAGTGTATGGCAGGTCTGGTGTACCAAATCCTTGTCGCCACTCTATGTGATCGTGCCTTATCTCGAGACATGC
TCCGGCGACTTGTTCTCCCTTGCTTGGTCTTCAACCCGCCAGGTTTTGTTTGTGGGTTGTCAGAACACTTCACTC
CAGTGGATCAGCTTCCGTTCACCATCAACATCGTCTCCTCCGGCAGAATCTACGTCGAGTGGAAAAACCACTCCC
ACCCATACATCCCGCCAAGCACACAAGTTCTTCGATAGCTATCCAATATATCAACGCAGACCTGCCGATGTCCAT
GCTTTCAATGTACTGCCCCGTCTCCATGGCCGCGATACACCAGACTTAGATCAAGCAGATATCACGCCTCCCCAG
GCCTATTTTAGTATACCCGCATGCAACGTTATCGATTCCGCGCATTGGGGCTACATCTACTGTATGGCTATTCTC
GACGACGAGGACGGCGTCCGACTTGCAACCGGTAGTGGAGACGAGGTTGTTAAAGTCAGTCTGCATGCCTTACCA
AGACACTTCTCTTGACCCAGAACCTTTATTCCAGCTCTGGGATTGTTCAGCAGATCGTCCAAACCTGATCCACCA
ATTTTCATGTGAGCATGGGGCGGTTCTATCGCTGGTGGCCAAAGGCGACATCATTGCTGCTGGCTGTCAGGATGG
ATATGTCAAGGTGCTTGACCTTGAGACCAAAACGGCCATTCGCACCATCATTGTTCAAGAGGTATTTTTTTCGGC
CTTTTTGATGACTGCTGGTTAATCTCTTCCAGGGTGTTGATATTCTGTCTTTGTCAATTTTTGACCAAGACTTAT
TCAGTTGCTCCGCCGATGGTCGTGTCAAGGTCATTTTGCTTCTATGGCGTTTTCTTGACCTTTACTCATTATCTC
ATTCCTTAGCGCTGGTCTTCAGCTTTCGATTGCATAGCTGAATGGGATGCACATACGAATATCGTACTGTCTTCT
GTCGTAACACAGTTCCCGACCGGTGGAATTTGCCTCACAACTGGTGGCAGTGACTCCCAAATCAAGGTCGCTCAC
AAAACAGTCACAAGTTTCCAAGATGTTGATTCATCGCTCTCTAGGTTTGGGAAGTGTTCACCCCCAAGGTTGGAC
AACAATCTCTCCAGAACAGATTCAGTTCTTCTTCCACTCAACAACTCACTGGCTCCGTGCCGCGCAACCTTGTAG
AAACCCTGTTTTATACCCTTTACAATTTTGTAGCCATACCAAGTGTGAGCTCACAACTGAAGCACAGAGAGGATT
GTCGACAAGCCGGTGTGTGGCTGAAAAAGTATCTGTCCCAACTCGGTGCTCAGGCTACACTTGTGAGCGATTTTG
CTTGTCTGTGAGACTCATACTCAGGGAAACAGCTTCCCACCGGTGAAGGTGGCAATCCGATTGTGCTAGGAACGT
TCGAGGGTCGGAAGAGTGACAAACCAAAACCTCGTATTCTCTTCTACGGGTTCGTTTCTTCCTACTACCACTGTT
TAGTCATTAACATCAAACGACCCGACTCATTAGACACTACGACGTCATTTCAGCTCCTCCAGAAGGCTGGGACTC
TGATCCGTTTGTCCTGACGGGGAAAAATGGATATCTATATGGGCGGGGTGTAACGGACGACAAGGGCCCGATAAT
TGCTGTCGCATGTGCTGCAGCCGATCTCATCGCCCAAAGGGCCCTGGGCGTTGATCTGGTCTTCTTGGTCGAGGG
TGAGGAGGAAGTGGGGAGTGCTCGATTCAACGAGACAGTAAGGAAGTACAAAGACTCGATTGGACACATTGATGA
AATTCTTGTTAGGTGAGTCATGTAATCATTCTGGTGGTTGTTGCTCATGATCTATCTCTACAGTAATTCCACTTG
GATCGCGGAAGATAGAGCTTGTTTGACCTATGGCTCGAGGGGTGTTATCCATTGTAGTATGGTTGTATGTCATCT
CCCCGGCTCGGTATGGTACTGCGGCTGATCTTGGTCCTCAGATTTCGAACGATAAGCCAGATCTACATTCCGGTA
TTGAAGGTGGTGTCACAGTGGAACCAATGACCGACATGTTCGTCCATTTTACTCTTATATGCACACAAGGGTTGA
TCAATTTCTTCACCTGCAGGGTTCACCTCCTTGCAAAACTTAGAGACTGTAGTGGTCGCATTCTAGTACCTGGCT
TCTGTTAGTGGTAGTTCATTCCAAGTCTCCACTCTTCCGGCTGACACTTGATGAAACCAGATGACTGTGTACAAC
CAGCCACGAAGGAAGAAGAAGAATTATATCAGTTACTGTCAGACGTGACTTGCAAACCCGCGTCACATTTACGTT
CGAGATGGTGTGAACCGTCCTTGACGATTCATAATATTGAGATAAGTGGGCCTAAGAGTACGCTTTTGACTCGTG
CTCAGCGCTTTGGAACTTACGATAAATGAAGATGCTACGATCATCCCCAGCAAGGTCAAAGCTCAAATTTCGTTG
CGTATCGTGCCCAATCAGGACCTTGAGGTTATTGTTGCCTCTGTAGTCTCTTTTCTCAAAAAGACTTTTGACGGT
TTCGAGAGTCCAAATAAACTCCAGGTTTGTCTCTTGGTTATTCAAACGAATGGTCCCCTTGACTTCTTTCCTCTC
AGGTTGATGTCCAACATACAGCGAACTGGTGGTTGGGCGAAGTCGATTATGACCCTTACTTTAAGGCCTTGGAGA
ATGCTGTCGCAAAAGAGTGGGATATGGAACCATTGCGGATACGAGAGGGTGGTGTGAGTAACTCATCGACTCGTA
ATCTATTCGGATTGCTGACACAGGTTTTTAAATAGTCTATCCCTTCTGTTCCTTGGCTTGAGAAAGAGTTTAAAT
GCCATGCGCTGCACCTGCCTATGGGGCAGAGTTCCGTGCGTTTCCGACTCTACTACTTTTGTGATTCTCGCAATT
AAACCTTCGTTTTTAGGACCAAGCGCATTTACCCAATGAGCGTATATCCCTGCTCAACTTACAAAAAGGAAAGGC
AGTTGTAGAAAAGTTTTTGATTGAGGTTGCAAATGAAGGGTTCATATCCCAGATACCGAAGGATGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail