Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|102120
Gene name
Locationscaffold_7:1256668..1258643
Strand+
Gene length (bp)1975
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 6.5E-67 42 370
PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain 4.6E-41 389 498
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 7.8E-18 216 290
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.8E-11 43 88
PF01134 GIDA Glucose inhibited division protein A 3.2E-09 43 201
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.1E-04 46 82
PF00890 FAD_binding_2 FAD binding domain 1.3E-07 43 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00087|DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 30 508 0.0E+00
sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 2 507 0.0E+00
sp|P09624|DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 37 507 0.0E+00
sp|Q60HG3|DLDH_MACFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 10 508 0.0E+00
sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 10 508 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00087|DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 30 508 0.0E+00
sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 2 507 0.0E+00
sp|P09624|DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 37 507 0.0E+00
sp|Q60HG3|DLDH_MACFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 10 508 0.0E+00
sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 10 508 0.0E+00
sp|Q5R4B1|DLDH_PONAB Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1 10 508 0.0E+00
sp|Q8CIZ7|DLDH_CRIGR Dihydrolipoyl dehydrogenase, mitochondrial OS=Cricetulus griseus GN=DLD PE=2 SV=1 10 508 0.0E+00
sp|P49819|DLDH_CANLF Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis lupus familiaris GN=DLD PE=1 SV=1 10 508 0.0E+00
sp|P09623|DLDH_PIG Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 10 508 0.0E+00
sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 28 508 0.0E+00
sp|O08749|DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus GN=Dld PE=1 SV=2 11 508 0.0E+00
sp|Q6P6R2|DLDH_RAT Dihydrolipoyl dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Dld PE=1 SV=1 10 508 0.0E+00
sp|Q9M5K2|DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 28 508 0.0E+00
sp|Q811C4|DLDH_MESAU Dihydrolipoyl dehydrogenase, mitochondrial (Fragment) OS=Mesocricetus auratus GN=DLD PE=1 SV=1 23 495 0.0E+00
sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 33 508 0.0E+00
sp|Q9SPB1|LEGRE_VIGUN Leghemoglobin reductase OS=Vigna unguiculata GN=FLBR PE=1 SV=1 31 505 0.0E+00
sp|Q54EW8|DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1 56 508 0.0E+00
sp|O18480|DLDH_MANSE Dihydrolipoyl dehydrogenase OS=Manduca sexta PE=2 SV=1 12 508 0.0E+00
sp|Q41219|LEGRE_SOYBN Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 32 505 0.0E+00
sp|Q9HUY1|DLDH3_PSEAE Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpd3 PE=3 SV=1 40 507 3.0E-167
sp|P31046|DLDH3_PSEPU Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas putida GN=lpd3 PE=1 SV=1 42 508 2.0E-164
sp|Q04933|DLDH_TRYBB Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 32 508 2.0E-160
sp|P90597|DLDH_TRYCR Dihydrolipoyl dehydrogenase OS=Trypanosoma cruzi GN=LPD PE=1 SV=1 32 508 3.0E-160
sp|P95596|DLDH_RHOCA Dihydrolipoyl dehydrogenase OS=Rhodobacter capsulatus GN=lpd PE=3 SV=1 42 507 3.0E-157
sp|P14218|DLDH_PSEFL Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 39 508 2.0E-153
sp|Q9I3D1|DLDH2_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 39 508 2.0E-153
sp|P31052|DLDH2_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 39 508 1.0E-149
sp|P52992|DLDH_CUPNH Dihydrolipoyl dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhL PE=3 SV=2 39 508 5.0E-147
sp|P18925|DLDH_AZOVI Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 39 508 3.0E-146
sp|P11959|DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 43 508 8.0E-120
sp|P85207|DLDH_THESS Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 42 508 5.0E-119
sp|P0A0E7|DLDH_STAAW Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|P0A0E8|DLDH_STAAU Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|Q6GAB8|DLDH_STAAS Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|Q6GHY9|DLDH_STAAR Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|P99084|DLDH_STAAN Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain N315) GN=pdhD PE=1 SV=1 43 507 1.0E-117
sp|P0A0E6|DLDH_STAAM Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|Q5HGY8|DLDH_STAAC Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain COL) GN=pdhD PE=3 SV=1 43 507 1.0E-117
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 43 508 2.0E-113
sp|Q9HN74|DLDH_HALSA Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 43 507 3.0E-110
sp|O84561|DLDH_CHLTR Dihydrolipoyl dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lpdA PE=3 SV=1 39 508 9.0E-109
sp|Q9PJI3|DLDH_CHLMU Dihydrolipoyl dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lpdA PE=3 SV=1 39 508 2.0E-108
sp|P43784|DLDH_HAEIN Dihydrolipoyl dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lpdA PE=3 SV=2 44 498 1.0E-107
sp|Q9Z773|DLDH_CHLPN Dihydrolipoyl dehydrogenase OS=Chlamydia pneumoniae GN=lpdA PE=3 SV=1 39 508 2.0E-107
sp|Q5UWH2|DLDH3_HALMA Dihydrolipoyl dehydrogenase 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA3 PE=3 SV=1 43 507 4.0E-107
sp|Q04829|DLDH_HALVD Dihydrolipoyl dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lpdA PE=1 SV=3 35 507 4.0E-106
sp|O50286|DLDH_VIBPA Dihydrolipoyl dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lpd PE=3 SV=2 44 498 2.0E-102
sp|P0A9P3|DLDH_SHIFL Dihydrolipoyl dehydrogenase OS=Shigella flexneri GN=lpdA PE=3 SV=2 44 498 8.0E-101
sp|P0A9P0|DLDH_ECOLI Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) GN=lpdA PE=1 SV=2 44 498 8.0E-101
sp|P0A9P1|DLDH_ECOL6 Dihydrolipoyl dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lpdA PE=3 SV=2 44 498 8.0E-101
sp|P0A9P2|DLDH_ECO57 Dihydrolipoyl dehydrogenase OS=Escherichia coli O157:H7 GN=lpdA PE=3 SV=2 44 498 8.0E-101
sp|Q9KPF6|DLDH_VIBCH Dihydrolipoyl dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lpd PE=3 SV=1 44 498 2.0E-99
sp|Q9I1L9|DLDH1_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdV PE=1 SV=1 44 508 1.0E-96
sp|P54533|DLDH2_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=bfmBC PE=3 SV=1 42 508 2.0E-96
sp|Q5UYG6|DLDH2_HALMA Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 43 507 1.0E-95
sp|P57303|DLDH_BUCAI Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lpdA PE=3 SV=1 44 494 2.0E-90
sp|Q50068|DLDH_MYCLE Dihydrolipoyl dehydrogenase OS=Mycobacterium leprae (strain TN) GN=lpd PE=3 SV=1 42 508 3.0E-88
sp|Q02733|IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC15 PE=1 SV=1 42 501 4.0E-88
sp|O50311|DLDH_CHLP8 Dihydrolipoyl dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lpd PE=3 SV=2 37 501 2.0E-87
sp|Q8NTE1|DLDH_CORGL Dihydrolipoyl dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lpd PE=1 SV=1 39 508 4.0E-87
sp|Q8KCW2|DLDH_CHLTE Dihydrolipoyl dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lpd PE=3 SV=1 37 501 3.0E-86
sp|O05940|DLDH_RHIEC Dihydrolipoyl dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lpdA PE=3 SV=2 39 504 4.0E-86
sp|P50970|DLDH_ZYMMO Dihydrolipoyl dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lpd PE=3 SV=3 39 508 6.0E-85
sp|P9WHH9|DLDH_MYCTU Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdC PE=1 SV=1 42 508 2.0E-82
sp|P9WHH8|DLDH_MYCTO Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdC PE=3 SV=1 42 508 2.0E-82
sp|P66005|DLDH_MYCBO Dihydrolipoyl dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lpd PE=3 SV=1 42 508 2.0E-82
sp|Q8K9T7|DLDH_BUCAP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lpdA PE=3 SV=1 43 503 1.0E-81
sp|Q89AQ8|DLDH_BUCBP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lpdA PE=3 SV=1 44 503 9.0E-79
sp|P09063|DLDH1_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdV PE=1 SV=1 54 508 2.0E-78
sp|O34324|DLDH3_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=acoL PE=3 SV=1 73 507 1.0E-77
sp|P0A0E4|MERA_STAES Mercuric reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=merA PE=3 SV=1 42 499 3.0E-74
sp|P0A0E5|MERA_STAAU Mercuric reductase OS=Staphylococcus aureus GN=merA PE=3 SV=1 42 499 3.0E-74
sp|P16171|MERA_BACCE Mercuric reductase OS=Bacillus cereus GN=merA PE=1 SV=1 42 499 4.0E-73
sp|P72740|DLDH_SYNY3 Dihydrolipoyl dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lpdA PE=1 SV=3 42 497 1.0E-72
sp|A8MS68|PLPD1_ARATH Dihydrolipoyl dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=LPD1 PE=2 SV=1 58 501 7.0E-71
sp|P30341|MERA_STRLI Mercuric reductase OS=Streptomyces lividans GN=merA PE=2 SV=1 66 498 1.0E-69
sp|F4JLP5|PLPD2_ARATH Dihydrolipoyl dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=LPD2 PE=2 SV=2 34 501 6.0E-69
sp|P75393|DLDH_MYCPN Dihydrolipoyl dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhD PE=3 SV=1 42 501 5.0E-68
sp|A8GL77|STHA_SERP5 Soluble pyridine nucleotide transhydrogenase OS=Serratia proteamaculans (strain 568) GN=sthA PE=3 SV=1 42 499 5.0E-65
sp|P9WHH5|STHA_MYCTU Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sthA PE=1 SV=1 42 504 3.0E-63
sp|P9WHH4|STHA_MYCTO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sthA PE=3 SV=1 42 504 3.0E-63
sp|A5U665|STHA_MYCTA Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sthA PE=3 SV=1 42 504 3.0E-63
sp|C1AFH2|STHA_MYCBT Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sthA PE=3 SV=1 42 504 3.0E-63
sp|A1KM51|STHA_MYCBP Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sthA PE=3 SV=1 42 504 3.0E-63
sp|P66007|STHA_MYCBO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sthA PE=3 SV=1 42 504 3.0E-63
sp|B1J606|STHA_PSEPW Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain W619) GN=sthA PE=3 SV=1 42 498 4.0E-63
sp|Q48A14|STHA_COLP3 Soluble pyridine nucleotide transhydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sthA PE=3 SV=1 42 499 5.0E-63
sp|Q7MQ83|STHA_VIBVY Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain YJ016) GN=sthA PE=3 SV=1 42 499 5.0E-63
sp|Q8DD46|STHA_VIBVU Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=sthA PE=3 SV=1 42 499 5.0E-63
sp|Q5E212|STHA_VIBF1 Soluble pyridine nucleotide transhydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=sthA PE=3 SV=2 39 499 1.0E-62
sp|A4VMU6|STHA_PSEU5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=sthA PE=3 SV=1 42 499 2.0E-62
sp|Q88KY8|STHA_PSEPK Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain KT2440) GN=sthA PE=3 SV=3 42 498 2.0E-62
sp|A5W6F5|STHA_PSEP1 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sthA PE=3 SV=1 42 498 2.0E-62
sp|B0KH90|STHA_PSEPG Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain GB-1) GN=sthA PE=3 SV=1 42 498 3.0E-62
sp|Q3K9F5|STHA_PSEPF Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=sthA PE=3 SV=1 42 498 6.0E-62
sp|A4XSQ1|STHA_PSEMY Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas mendocina (strain ymp) GN=sthA PE=3 SV=1 42 499 8.0E-62
sp|Q9XBQ9|STHA_AZOVI Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii GN=sthA PE=1 SV=1 42 498 8.0E-62
sp|C1DR10|STHA_AZOVD Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sthA PE=3 SV=1 42 498 8.0E-62
sp|A6V3A6|STHA_PSEA7 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=sthA PE=3 SV=1 42 499 9.0E-62
sp|A1JI37|STHA_YERE8 Soluble pyridine nucleotide transhydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sthA PE=3 SV=1 42 499 1.0E-61
sp|P57112|STHA_PSEAE Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sthA PE=1 SV=2 42 499 1.0E-61
sp|Q02PF5|STHA_PSEAB Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sthA PE=3 SV=1 42 499 1.0E-61
sp|B7UZU5|STHA_PSEA8 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=sthA PE=3 SV=1 42 499 1.0E-61
sp|Q884I6|STHA_PSESM Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sthA PE=3 SV=3 42 498 2.0E-61
sp|Q1I7F0|STHA_PSEE4 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas entomophila (strain L48) GN=sthA PE=3 SV=1 42 498 2.0E-61
sp|C3LPZ2|STHA_VIBCM Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sthA PE=3 SV=1 42 499 2.0E-61
sp|P50529|STHA_VIBCH Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sthA PE=3 SV=2 42 499 2.0E-61
sp|A5F4K5|STHA_VIBC3 Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sthA PE=3 SV=1 42 499 2.0E-61
sp|Q4ZV77|STHA_PSEU2 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sthA PE=3 SV=2 42 498 2.0E-61
sp|Q4KFA6|STHA_PSEF5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sthA PE=3 SV=1 42 498 3.0E-61
sp|Q48KI8|STHA_PSE14 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sthA PE=3 SV=1 42 498 3.0E-61
sp|O05139|STHA_PSEFL Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens GN=sthA PE=1 SV=3 42 498 4.0E-61
sp|Q6LLT9|STHA_PHOPR Soluble pyridine nucleotide transhydrogenase OS=Photobacterium profundum GN=sthA PE=3 SV=1 42 499 4.0E-61
sp|C3K4W1|STHA_PSEFS Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=sthA PE=3 SV=1 42 498 4.0E-61
sp|B7VM91|STHA_VIBTL Soluble pyridine nucleotide transhydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=sthA PE=3 SV=1 39 499 6.0E-61
sp|P47513|DLDH_MYCGE Dihydrolipoyl dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhD PE=3 SV=1 42 501 9.0E-61
sp|B1JQ50|STHA_YERPY Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|Q66G61|STHA_YERPS Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|A4TRG4|STHA_YERPP Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis (strain Pestoides F) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|Q1CNP4|STHA_YERPN Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|A9R6N5|STHA_YERPG Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|Q8ZA97|STHA_YERPE Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|B2JZF3|STHA_YERPB Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|Q1CBU5|STHA_YERPA Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|A7FD10|STHA_YERP3 Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sthA PE=3 SV=1 42 499 2.0E-60
sp|Q87KN5|STHA_VIBPA Soluble pyridine nucleotide transhydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sthA PE=3 SV=1 42 499 4.0E-60
sp|B4F1H1|STHA_PROMH Soluble pyridine nucleotide transhydrogenase OS=Proteus mirabilis (strain HI4320) GN=sthA PE=3 SV=1 42 499 7.0E-60
sp|Q1QX78|STHA_CHRSD Soluble pyridine nucleotide transhydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=sthA PE=3 SV=1 38 498 2.0E-59
sp|Q6CZB1|STHA_PECAS Soluble pyridine nucleotide transhydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sthA PE=3 SV=1 42 499 2.0E-59
sp|B5XZ14|STHA_KLEP3 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae (strain 342) GN=sthA PE=3 SV=1 37 499 2.0E-59
sp|B2VGA0|STHA_ERWT9 Soluble pyridine nucleotide transhydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sthA PE=3 SV=1 39 499 3.0E-59
sp|B5REZ6|STHA_SALG2 Soluble pyridine nucleotide transhydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sthA PE=3 SV=1 39 499 3.0E-59
sp|C0Q478|STHA_SALPC Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|Q57H91|STHA_SALCH Soluble pyridine nucleotide transhydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|P66008|STHA_SALTY Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sthA PE=3 SV=2 39 499 4.0E-59
sp|P66009|STHA_SALTI Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhi GN=sthA PE=3 SV=2 39 499 4.0E-59
sp|B5BJN6|STHA_SALPK Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|A9N0H2|STHA_SALPB Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|Q5PK71|STHA_SALPA Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|B5QXQ7|STHA_SALEP Soluble pyridine nucleotide transhydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=sthA PE=3 SV=1 39 499 4.0E-59
sp|A6TGE6|STHA_KLEP7 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sthA PE=3 SV=1 37 499 6.0E-59
sp|A6VW16|STHA_MARMS Soluble pyridine nucleotide transhydrogenase OS=Marinomonas sp. (strain MWYL1) GN=sthA PE=3 SV=1 42 504 1.0E-58
sp|B7MR55|STHA_ECO81 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O81 (strain ED1a) GN=sthA PE=3 SV=1 39 499 1.0E-58
sp|B1LNS2|STHA_ECOSM Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sthA PE=3 SV=1 39 499 2.0E-58
sp|Q8FB93|STHA_ECOL6 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sthA PE=3 SV=3 39 499 2.0E-58
sp|Q83MI1|STHA_SHIFL Soluble pyridine nucleotide transhydrogenase OS=Shigella flexneri GN=sthA PE=3 SV=1 39 499 2.0E-58
sp|A8AKW0|STHA_CITK8 Soluble pyridine nucleotide transhydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7LUN3|STHA_ESCF3 Soluble pyridine nucleotide transhydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|Q1R3U7|STHA_ECOUT Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B6I5I0|STHA_ECOSE Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SE11) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7NFR2|STHA_ECOLU Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|P27306|STHA_ECOLI Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12) GN=sthA PE=1 SV=5 39 499 4.0E-58
sp|A1AIE2|STHA_ECOK1 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O1:K1 / APEC GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B1XBX3|STHA_ECODH Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|C5A0R1|STHA_ECOBW Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7M718|STHA_ECO8A Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O8 (strain IAI1) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7NU38|STHA_ECO7I Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B5Z064|STHA_ECO5E Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7LA64|STHA_ECO55 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|B7MIA0|STHA_ECO45 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|A7ZUI2|STHA_ECO24 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sthA PE=3 SV=1 39 499 4.0E-58
sp|Q52109|MERA_ACICA Mercuric reductase OS=Acinetobacter calcoaceticus GN=merA PE=3 SV=1 41 498 5.0E-58
sp|B7UNU0|STHA_ECO27 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sthA PE=3 SV=1 39 499 5.0E-58
sp|B1IVB6|STHA_ECOLC Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sthA PE=3 SV=1 39 499 7.0E-58
sp|A8A770|STHA_ECOHS Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=sthA PE=3 SV=1 39 499 7.0E-58
sp|B2TWF7|STHA_SHIB3 Soluble pyridine nucleotide transhydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sthA PE=3 SV=1 39 499 1.0E-57
sp|Q8X727|STHA_ECO57 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 GN=sthA PE=3 SV=3 39 499 1.0E-57
sp|Q0TA96|STHA_ECOL5 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sthA PE=3 SV=1 39 499 2.0E-57
sp|Q2NQZ3|STHA_SODGM Soluble pyridine nucleotide transhydrogenase OS=Sodalis glossinidius (strain morsitans) GN=sthA PE=3 SV=1 42 499 4.0E-57
sp|A4WG49|STHA_ENT38 Soluble pyridine nucleotide transhydrogenase OS=Enterobacter sp. (strain 638) GN=sthA PE=3 SV=1 39 499 4.0E-57
sp|P94702|MERA_ENTAG Mercuric reductase OS=Enterobacter agglomerans GN=merA PE=3 SV=1 41 498 1.0E-56
sp|P00392|MERA_PSEAI Mercuric reductase OS=Pseudomonas aeruginosa GN=merA PE=1 SV=1 27 498 1.0E-56
sp|P17239|MERA_ACIFR Mercuric reductase OS=Acidithiobacillus ferrooxidans GN=merA PE=1 SV=2 44 498 3.0E-56
sp|A1U1Y5|STHA_MARHV Soluble pyridine nucleotide transhydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sthA PE=3 SV=1 38 499 1.0E-55
sp|Q7MBG9|STHA_PHOLL Soluble pyridine nucleotide transhydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sthA PE=3 SV=1 42 499 3.0E-55
sp|P94188|MERA_ALCSP Mercuric reductase OS=Alcaligenes sp. GN=merA PE=3 SV=1 72 498 5.0E-55
sp|P08332|MERA_SHIFL Mercuric reductase OS=Shigella flexneri GN=merA PE=3 SV=1 44 498 1.0E-53
sp|Q51772|MERA_PSEFL Mercuric reductase OS=Pseudomonas fluorescens GN=merA PE=3 SV=1 44 498 3.0E-53
sp|Q54465|MERA_SHEPU Mercuric reductase OS=Shewanella putrefaciens GN=merA PE=3 SV=1 44 498 9.0E-53
sp|P48642|GSHRC_ORYSJ Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2 42 494 2.0E-52
sp|Q2SIP2|STHA_HAHCH Soluble pyridine nucleotide transhydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=sthA PE=3 SV=1 38 499 3.0E-52
sp|Q43154|GSHRP_SPIOL Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1 38 494 7.0E-52
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 39 492 1.0E-51
sp|P23189|GSHR_PSEAE Glutathione reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gor PE=3 SV=1 42 494 4.0E-51
sp|C4K3I8|STHA_HAMD5 Soluble pyridine nucleotide transhydrogenase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sthA PE=3 SV=1 42 499 8.0E-50
sp|Q9Z0J5|TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 42 492 7.0E-49
sp|Q43621|GSHRC_PEA Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 42 494 9.0E-49
sp|Q9JLT4|TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 33 492 2.0E-48
sp|A2TIL1|GSHR_CALJA Glutathione reductase, mitochondrial OS=Callithrix jacchus GN=GSR PE=2 SV=1 42 492 5.0E-47
sp|Q873E8|GSHR_NEUCR Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 35 492 1.0E-46
sp|O04955|GSHRC_BRARP Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 42 494 1.0E-46
sp|P43783|GSHR_HAEIN Glutathione reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gor PE=3 SV=1 59 494 2.0E-46
sp|P35484|DLDH_ACHLA Dihydrolipoyl dehydrogenase (Fragment) OS=Acholeplasma laidlawii GN=pdhD PE=3 SV=1 54 386 3.0E-46
sp|P00390|GSHR_HUMAN Glutathione reductase, mitochondrial OS=Homo sapiens GN=GSR PE=1 SV=2 42 492 1.0E-45
sp|P91938|TRXR1_DROME Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 30 499 3.0E-44
sp|P47791|GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus GN=Gsr PE=1 SV=3 8 492 6.0E-44
sp|P06715|GSHR_ECOLI Glutathione reductase OS=Escherichia coli (strain K12) GN=gor PE=1 SV=1 59 494 1.0E-43
sp|P48638|GSHR_NOSS1 Glutathione reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gor PE=3 SV=2 42 494 2.0E-43
sp|P48641|GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 42 494 2.0E-43
sp|Q9N2I8|TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 42 492 2.0E-43
sp|P41921|GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLR1 PE=1 SV=2 26 492 6.0E-43
sp|P48639|GSHR_BURCE Glutathione reductase OS=Burkholderia cepacia GN=gor PE=3 SV=1 42 494 1.0E-42
sp|P78965|GSHR_SCHPO Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgr1 PE=3 SV=2 35 492 9.0E-42
sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=Homo sapiens GN=TXNRD2 PE=1 SV=3 42 492 2.0E-41
sp|P77212|RCLA_ECOLI Probable pyridine nucleotide-disulfide oxidoreductase RclA OS=Escherichia coli (strain K12) GN=rclA PE=2 SV=2 42 496 3.0E-41
sp|Q6HA23|GSHR_KLULA Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 42 492 4.0E-41
sp|P39051|TYTR_TRYBB Trypanothione reductase OS=Trypanosoma brucei brucei GN=TPR PE=1 SV=1 39 502 8.0E-41
sp|Q6FRV2|GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 30 492 2.0E-40
sp|P39040|TYTR_CRIFA Trypanothione reductase OS=Crithidia fasciculata GN=TPR PE=1 SV=1 39 502 6.0E-40
sp|P9WHH3|MTR_MYCTU Mycothione reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtr PE=1 SV=1 40 499 1.0E-39
sp|P9WHH2|MTR_MYCTO Mycothione reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtr PE=3 SV=1 40 499 1.0E-39
sp|Q6C5H4|GSHR_YARLI Glutathione reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLR1 PE=3 SV=1 38 492 2.0E-39
sp|P13110|TYTR_TRYCO Trypanothione reductase OS=Trypanosoma congolense GN=TPR PE=1 SV=1 39 492 3.0E-38
sp|Q74ZK4|GSHR_ASHGO Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 42 492 4.0E-38
sp|Q8T137|GSHR_DICDI Glutathione reductase OS=Dictyostelium discoideum GN=gsr PE=3 SV=2 37 492 4.0E-38
sp|Q25861|TRXR_PLAF5 Thioredoxin reductase OS=Plasmodium falciparum (isolate FCH-5) GN=TR PE=1 SV=1 42 494 2.0E-36
sp|Q9VNT5|TRXR2_DROME Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 38 499 4.0E-36
sp|P28593|TYTR_TRYCR Trypanothione reductase OS=Trypanosoma cruzi GN=TPR PE=1 SV=1 39 502 6.0E-36
sp|P61076|TRXR2_PLAF7 Thioredoxin reductase 2 OS=Plasmodium falciparum (isolate 3D7) GN=trxr2 PE=1 SV=2 42 494 9.0E-36
sp|Q17745|TRXR1_CAEEL Thioredoxin reductase 1 OS=Caenorhabditis elegans GN=trxr-1 PE=2 SV=3 42 494 5.0E-35
sp|P70619|GSHR_RAT Glutathione reductase (Fragment) OS=Rattus norvegicus GN=Gsr PE=2 SV=2 81 492 5.0E-35
sp|P80461|GSHRP_TOBAC Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1 42 494 1.0E-34
sp|P27456|GSHRP_PEA Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1 42 494 1.0E-34
sp|P30635|GSHR_CAEEL Probable glutathione reductase 2 OS=Caenorhabditis elegans GN=trxr-2 PE=3 SV=2 38 494 3.0E-34
sp|O15770|GSHR_PLAF7 Glutathione reductase OS=Plasmodium falciparum (isolate 3D7) GN=GR3 PE=2 SV=4 42 494 5.0E-34
sp|Q60151|GSHR_STRTR Glutathione reductase OS=Streptococcus thermophilus GN=gor PE=3 SV=1 42 494 5.0E-34
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 76 494 2.0E-33
sp|Q94655|GSHR_PLAFK Glutathione reductase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=GR2 PE=1 SV=3 42 494 2.0E-33
sp|P42770|GSHRP_ARATH Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1 42 494 2.0E-33
sp|P39050|TYTR_LEIDO Trypanothione reductase OS=Leishmania donovani GN=TPR PE=3 SV=1 39 502 4.0E-33
sp|O62768|TRXR1_BOVIN Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 73 494 5.0E-33
sp|B9A1H3|TRXR1_EMIHU Thioredoxin reductase SEP1 OS=Emiliania huxleyi GN=SEP1 PE=1 SV=1 35 494 6.0E-33
sp|O89049|TRXR1_RAT Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus GN=Txnrd1 PE=1 SV=5 73 494 1.0E-32
sp|Q5NVA2|TRXR1_PONAB Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii GN=TXNRD1 PE=2 SV=3 59 494 1.0E-32
sp|P48640|GSHRP_SOYBN Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1 20 494 3.0E-32
sp|Q9JMH6|TRXR1_MOUSE Thioredoxin reductase 1, cytoplasmic OS=Mus musculus GN=Txnrd1 PE=1 SV=3 73 494 4.0E-32
sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 59 494 8.0E-32
sp|Q9MYY8|TRXR1_PIG Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa GN=TXNRD1 PE=2 SV=3 73 494 9.0E-32
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 76 494 2.0E-31
sp|P9WHH7|LPDA_MYCTU NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdA PE=1 SV=1 44 498 6.0E-30
sp|P9WHH6|LPDA_MYCTO NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdA PE=3 SV=1 44 498 6.0E-30
sp|Q6BPI1|GSHR_DEBHA Glutathione reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLR1 PE=3 SV=3 38 492 8.0E-30
sp|P08662|MERA_SERMA Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 38 243 2.0E-21
sp|Q56839|XECC_XANP2 2-oxopropyl-CoM reductase, carboxylating OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecC PE=1 SV=1 42 481 3.0E-17
sp|P80647|DLDH_HYMDI Dihydrolipoyl dehydrogenase (Fragment) OS=Hymenolepis diminuta PE=1 SV=1 43 89 6.0E-17
sp|P71317|STHA_PECCC Soluble pyridine nucleotide transhydrogenase (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=sthA PE=3 SV=1 362 499 2.0E-16
sp|Q6GIM7|TRXB_STAAR Thioredoxin reductase OS=Staphylococcus aureus (strain MRSA252) GN=trxB PE=3 SV=1 42 356 6.0E-12
sp|Q8CPY8|TRXB_STAES Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 42 356 1.0E-11
sp|Q5HQW4|TRXB_STAEQ Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 42 356 1.0E-11
sp|P66011|TRXB_STAAW Thioredoxin reductase OS=Staphylococcus aureus (strain MW2) GN=trxB PE=1 SV=1 42 356 2.0E-11
sp|Q6GB66|TRXB_STAAS Thioredoxin reductase OS=Staphylococcus aureus (strain MSSA476) GN=trxB PE=3 SV=1 42 356 2.0E-11
sp|P99101|TRXB_STAAN Thioredoxin reductase OS=Staphylococcus aureus (strain N315) GN=trxB PE=1 SV=1 42 356 2.0E-11
sp|P66010|TRXB_STAAM Thioredoxin reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxB PE=3 SV=1 42 356 2.0E-11
sp|Q5HHQ4|TRXB_STAAC Thioredoxin reductase OS=Staphylococcus aureus (strain COL) GN=trxB PE=3 SV=1 42 356 2.0E-11
sp|P08655|YMER_STAAU Uncharacterized 19.7 kDa protein in mercuric resistance operon OS=Staphylococcus aureus PE=4 SV=1 322 489 6.0E-11
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 163 361 9.0E-11
sp|P08662|MERA_SERMA Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 355 498 2.0E-10
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 215 395 7.0E-10
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 178 356 7.0E-10
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 163 361 8.0E-10
sp|Q5HIR6|AHPF_STAAC Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 40 357 1.0E-09
sp|O05204|AHPF_STAA8 Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 40 357 1.0E-09
sp|P66013|AHPF_STAAW Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 40 357 8.0E-09
sp|P99118|AHPF_STAAN Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 40 357 8.0E-09
sp|P66012|AHPF_STAAM Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 40 357 8.0E-09
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 178 357 9.0E-09
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 119 350 1.0E-08
sp|Q6GC92|AHPF_STAAS Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 40 357 1.0E-08
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 114 401 2.0E-08
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 178 355 2.0E-08
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 163 355 3.0E-08
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 163 355 3.0E-08
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 163 355 3.0E-08
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 163 355 3.0E-08
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 178 356 4.0E-08
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 178 356 4.0E-08
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 163 355 4.0E-08
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 178 356 5.0E-08
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 163 355 5.0E-08
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 163 355 5.0E-08
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 163 355 5.0E-08
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 212 360 5.0E-08
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 178 460 6.0E-08
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 178 356 6.0E-08
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 178 356 6.0E-08
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 178 356 6.0E-08
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 178 356 7.0E-08
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 178 356 7.0E-08
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 163 355 1.0E-07
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 178 355 1.0E-07
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 178 355 1.0E-07
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 163 355 1.0E-07
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 163 355 1.0E-07
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 163 355 2.0E-07
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 163 356 2.0E-07
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 178 355 2.0E-07
sp|Q6D8S1|NORW_PECAS Nitric oxide reductase FlRd-NAD(+) reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=norW PE=3 SV=1 169 356 2.0E-07
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 215 356 2.0E-07
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 178 355 2.0E-07
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 178 356 3.0E-07
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 167 457 5.0E-07
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 215 355 5.0E-07
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 207 401 5.0E-07
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 211 356 6.0E-07
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 215 355 7.0E-07
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 162 363 1.0E-06
sp|P37062|NAPE_ENTFA NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 217 358 2.0E-06
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 215 361 3.0E-06
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 215 355 3.0E-06
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 215 361 4.0E-06
sp|A9MFX5|NORW_SALAR Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=norW PE=3 SV=1 215 356 5.0E-06
sp|P92947|MDAR5_ARATH Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 177 361 5.0E-06
sp|Q928B5|TRXB_LISIN Thioredoxin reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxB PE=3 SV=1 35 356 6.0E-06
sp|Q979Y7|GGR_THEVO Digeranylgeranylglycerophospholipid reductase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1023 PE=3 SV=1 40 126 7.0E-06
sp|Q7N4V5|HCAD_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 215 358 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0045454 cell redox homeostasis Yes
GO:0003674 molecular_function No
GO:0065008 regulation of biological quality No
GO:0050794 regulation of cellular process No
GO:0003824 catalytic activity No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0042592 homeostatic process No
GO:0019725 cellular homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|102120
MLQLRRVAQVSLPKAGRHWRQSGVQSGTWQAYRGLATASEPYDVVVIGGGPGGYVAAIKAAQLGLKTACVEKRGS
LGGTCLNVGCIPSKAMLNNSHIYHQTQHDLERRGIDVSGVSLNLPKMLEAKDNAVTSLTKGIEFLFKANKVDYIK
GTASFTSSTSLSVSLLDGGSTAVDAKNFVIATGSEVAPFPGGAIKIDEKQIVSSTGALELQEVPKKMVVIGGGII
GLEMGSVWSRLGAEVTVVEFLDAIGGVGIDSEVAKQFQRTLTKQGLKFKLQTKVLSADKKDGKVHLVAESAKDGK
QETLKADVVLVAVGRRPYTDGLNLEAAGVEKDARGRVVIDDQFNTSAKNIRCIGDVTFGPMLAHKAEEEGIAAVE
YIKSGHGHVNYNAIPSVVYTHPEVAWVGRTEQDLKAEGVKYNVGKFNFSANSRAKTNLDSDGFVKILTEKETDKI
LGVHIIGPNAGEMIAEGVLAVEYGASAEDIGRTTHAHPTLSEAFKEAAMAAYGKPIHM*
Coding >AgabiH97|102120
ATGCTCCAGCTTCGACGAGTAGCTCAAGTCAGTTTGCCAAAAGCTGGCCGCCACTGGCGGCAATCAGGTGTTCAA
TCGGGTACTTGGCAAGCGTACCGGGGGCTCGCGACTGCTTCGGAGCCATATGATGTTGTAGTTATTGGCGGTGGT
CCGGGAGGATACGTGGCTGCCATTAAGGCAGCACAGTTAGGGCTCAAGACTGCTTGTGTCGAAAAACGCGGTTCT
CTCGGTGGAACATGTCTCAACGTTGGATGCATTCCGTCAAAGGCCATGCTTAATAATTCACATATCTACCACCAA
ACTCAACACGACCTTGAGCGTCGTGGTATTGATGTAAGCGGTGTCTCGCTTAACCTCCCAAAGATGCTTGAAGCC
AAAGACAATGCTGTGACTAGCCTAACGAAAGGTATCGAATTCCTTTTCAAAGCCAACAAAGTCGACTACATCAAG
GGCACTGCTTCTTTCACTTCCTCAACGTCCCTTTCCGTCTCTCTTCTTGACGGAGGATCAACCGCTGTCGATGCC
AAGAACTTTGTTATTGCTACTGGGTCTGAAGTTGCTCCTTTCCCCGGAGGTGCAATCAAAATCGACGAAAAACAG
ATTGTAAGCTCGACTGGTGCACTTGAGTTGCAAGAAGTTCCCAAAAAGATGGTTGTTATTGGTGGTGGAATTATC
GGACTTGAGATGGGTAGTGTTTGGAGCAGACTAGGAGCTGAGGTTACGGTAGTCGAATTCCTTGACGCAATCGGT
GGCGTCGGCATCGACTCTGAGGTCGCTAAGCAATTCCAGAGGACATTGACCAAACAGGGACTCAAATTCAAACTC
CAGACCAAGGTCCTATCGGCCGACAAGAAAGACGGCAAGGTACATTTAGTCGCTGAATCCGCCAAAGATGGTAAA
CAAGAAACTCTCAAAGCCGATGTTGTTCTCGTCGCTGTTGGTCGTCGCCCATATACTGATGGCCTCAACCTTGAG
GCAGCCGGTGTTGAGAAGGATGCTCGCGGTCGTGTCGTCATCGATGACCAGTTCAACACTTCGGCGAAAAATATC
CGATGCATCGGAGATGTTACTTTCGGCCCCATGTTAGCCCACAAGGCTGAGGAAGAAGGTATTGCTGCCGTTGAA
TACATCAAGTCGGGACACGGTCACGTCAATTATAATGCTATACCCTCCGTTGTCTACACTCACCCTGAAGTTGCA
TGGGTTGGCCGTACAGAACAAGACCTCAAAGCTGAGGGCGTCAAATACAATGTTGGCAAATTCAACTTTTCAGCC
AACTCTCGTGCAAAGACGAACCTGGATTCGGATGGCTTTGTTAAAATCTTAACTGAAAAAGAGACGGATAAGATT
CTGGGTGTGCATATCATTGGACCCAACGCGGGCGAGATGATTGCTGAAGGTGTTCTTGCAGTTGAGTACGGTGCC
AGCGCAGAGGATATTGGTAGGACTACTCACGCCCACCCCACATTATCGGAAGCATTCAAGGAGGCTGCTATGGCT
GCCTATGGAAAACCCATTCACATGTAA
Transcript >AgabiH97|102120
ATGCTCCAGCTTCGACGAGTAGCTCAAGTCAGTTTGCCAAAAGCTGGCCGCCACTGGCGGCAATCAGGTGTTCAA
TCGGGTACTTGGCAAGCGTACCGGGGGCTCGCGACTGCTTCGGAGCCATATGATGTTGTAGTTATTGGCGGTGGT
CCGGGAGGATACGTGGCTGCCATTAAGGCAGCACAGTTAGGGCTCAAGACTGCTTGTGTCGAAAAACGCGGTTCT
CTCGGTGGAACATGTCTCAACGTTGGATGCATTCCGTCAAAGGCCATGCTTAATAATTCACATATCTACCACCAA
ACTCAACACGACCTTGAGCGTCGTGGTATTGATGTAAGCGGTGTCTCGCTTAACCTCCCAAAGATGCTTGAAGCC
AAAGACAATGCTGTGACTAGCCTAACGAAAGGTATCGAATTCCTTTTCAAAGCCAACAAAGTCGACTACATCAAG
GGCACTGCTTCTTTCACTTCCTCAACGTCCCTTTCCGTCTCTCTTCTTGACGGAGGATCAACCGCTGTCGATGCC
AAGAACTTTGTTATTGCTACTGGGTCTGAAGTTGCTCCTTTCCCCGGAGGTGCAATCAAAATCGACGAAAAACAG
ATTGTAAGCTCGACTGGTGCACTTGAGTTGCAAGAAGTTCCCAAAAAGATGGTTGTTATTGGTGGTGGAATTATC
GGACTTGAGATGGGTAGTGTTTGGAGCAGACTAGGAGCTGAGGTTACGGTAGTCGAATTCCTTGACGCAATCGGT
GGCGTCGGCATCGACTCTGAGGTCGCTAAGCAATTCCAGAGGACATTGACCAAACAGGGACTCAAATTCAAACTC
CAGACCAAGGTCCTATCGGCCGACAAGAAAGACGGCAAGGTACATTTAGTCGCTGAATCCGCCAAAGATGGTAAA
CAAGAAACTCTCAAAGCCGATGTTGTTCTCGTCGCTGTTGGTCGTCGCCCATATACTGATGGCCTCAACCTTGAG
GCAGCCGGTGTTGAGAAGGATGCTCGCGGTCGTGTCGTCATCGATGACCAGTTCAACACTTCGGCGAAAAATATC
CGATGCATCGGAGATGTTACTTTCGGCCCCATGTTAGCCCACAAGGCTGAGGAAGAAGGTATTGCTGCCGTTGAA
TACATCAAGTCGGGACACGGTCACGTCAATTATAATGCTATACCCTCCGTTGTCTACACTCACCCTGAAGTTGCA
TGGGTTGGCCGTACAGAACAAGACCTCAAAGCTGAGGGCGTCAAATACAATGTTGGCAAATTCAACTTTTCAGCC
AACTCTCGTGCAAAGACGAACCTGGATTCGGATGGCTTTGTTAAAATCTTAACTGAAAAAGAGACGGATAAGATT
CTGGGTGTGCATATCATTGGACCCAACGCGGGCGAGATGATTGCTGAAGGTGTTCTTGCAGTTGAGTACGGTGCC
AGCGCAGAGGATATTGGTAGGACTACTCACGCCCACCCCACATTATCGGAAGCATTCAAGGAGGCTGCTATGGCT
GCCTATGGAAAACCCATTCACATGTAA
Gene >AgabiH97|102120
ATGCTCCAGCTTCGACGAGTAGCTCAAGTCGTAATTATTCTCCCTCGTGAACCACCTACACGACTCTGACGCGTC
CTTATAGAGTTTGCCAAAAGCTGGCCGCCACTGGCGGCAATCAGGTGTTCAATCGGGTACTTGGCAAGCGTACCG
GGGGCTCGCGACTGCTTCGGAGCCATATGATGTTGTAGTTATTGGCGGTGGTACGTATATTACCTCGTCAGTTGG
AACTTGCTTATGGAATTTATAATTTACAAGGTCCGGGAGGATACGTGGCTGCCATTAAGGCAGCACAGTTAGGGC
TCAAGGTACATTTTGCTTTAGATGTTGCCGGCTAATACTAAATTCAGTTACTCTCTCTCTGCAGACTGCTTGTGT
CGAAAAACGCGGTTCTCTCGGTGGAACATGTCTCAACGTTGGATGCATTCCGTCAAAGGCCATGCTTAATAATTC
ACATATCTACCACCAAACTCAACACGACCTTGAGCGTCGTGGTATTGATGGTATGTCATTAATGTTCTGCCCAGC
ACCTCTGTTCTGAATGTTTACTGTACCTCAGTAAGCGGTGTCTCGCTTAACCTCCCAAAGATGCTTGAAGCCAAA
GACAATGCTGTGACTAGCCTAACGAAAGGTATCGAATTCCTTTTCAAAGCCAACAAAGTCGACTACATCAAGGGC
ACTGCTTCTTTCACTTCCTCAACGTCCCTTTCCGTCTCTCTTCTTGACGGAGGATCAACCGCTGTCGATGCCAAG
AACTTTGTTATTGCTACTGGGTCTGAAGTTGCTCCTTTCCCCGGAGGTGCAATCAAAATCGACGAAAAACAGATT
GTAAGCTCGACTGGTGCACTTGAGTTGCAAGAAGTTCCCAAAAAGATGGTTGTTATTGGTGGTGGAATTATCGGA
CTTGAGATGGGTAGTGTTTGGAGCAGACTAGGAGCTGAGGTTACGGTAGTCGAATTCCTTGACGCAATCGGTGGC
GTCGGCATCGACTCTGAGGTCGCGTACGTGACTCATCTTGTGCCTCAGTTTGAAACGGACTGACCTGTTTTTGCA
GTAAGCAATTCCAGAGGACATTGACCAAACAGGGACTCAAATTCAAACTCCAGACCAAGGTCCTATCGGCCGACA
AGAAAGACGGCAAGGTACATTTAGTCGCTGAATCCGCCAAAGATGGTAAACAAGAAACTGTAGGCCCCTTTTTCC
GAAATTTTGTGATTCGGCACTAACTGAGCAAAAAATAGCTCAAAGCCGATGTTGTTCTCGTCGCTGTTGGTCGTC
GCCCATATACTGATGGCCTCAACCTTGAGGCAGCCGGTGTTGAGAAGGATGCTCGCGGTCGTGTCGTCATCGATG
ACCAGTTCAACACTTCGGCGAAAAATATCCGATGCATCGGAGATGTTACTTTCGGCCCCATGTTAGCCCACAAGG
CTGAGGAAGAAGGTGTGTATATATTCTTTTGGTCCACACATTCACAAGGATCGTCATTCATAACATTCAATAGGT
ATTGCTGCCGTTGAATACATCAAGTCGGGACACGGTCACGTCAATTATAATGCTATACCCTCCGTTGTCTACACT
CACCCTGAAGTTGCATGGGTTGGCCGTACAGAACAAGACCTCAAAGCTGAGGGCGTCAAATACAATGTTGGCAAA
TTCAACTTTTCAGCCAACTCTCGTGCAAAGACGAACCTGGATTCGGATGGCTTTGTTAAAATCTTAACTGAAAAA
GAGACGGATAAGATTCTGGGTGTGCATATCATTGGACCCAACGCGGGCGAGATGATTGCTGAAGGTGTTCTTGCA
GTTGAGTACGGTGCCAGCGCAGAGGATATTGGTAGGACTACTCACGCCCACGTACGTGTGTTTTCTTCTTATCTT
CCCTCTGGTGTTAATGGTTATGTCCTTTGTTCAGCCCACATTATCGGAAGCATTCAAGGAGGCTGCTATGGCTGC
CTATGGAAAACCCATTCACATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail