Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101920
Gene name
Locationscaffold_7:1208874..1210581
Strand+
Gene length (bp)1707
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04577 Glyco_transf_61 Glycosyltransferase 61 2.0E-12 165 389

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 85.12 46.66 123.57
Initials Initials knots 43.80 25.84 61.77
Pileal_Stipeal_center Stage I stipe center 97.94 58.42 137.45
Pileal_Stipeal_shell Stage I stipe shell 87.41 52.08 122.74
DIF_stipe_center Stage II stipe center 104.86 62.83 146.88
DIF_stipe_shell Stage II stipe shell 127.74 75.84 179.65
DIF_stipe_skin Stage II stipe skin 121.19 72.09 170.29
DIF_cap_skin Stage II cap skin 153.99 90.53 217.44
DIF_cap_tissue Stage II cap tissue 108.10 63.91 152.29
DIF_gill_tissue Stage II gill tissue 73.38 44.11 102.64
YFB_stipe_center Young fruiting body stipe center 110.08 65.16 155.00
YFB_stipe_shell Young fruiting body stipe shell 131.08 76.91 185.26
YFB_stipe_skin Young fruiting body stipe skin 126.81 75.44 178.17
YFB_cap_skin Young fruiting body cap skin 174.31 102.13 246.50
YFB_cap_tissue Young fruiting body cap tissue 124.22 73.89 174.55
YFB_gill_tissue Young fruiting body gill tissue 155.83 89.81 221.84
YFB_veil Young fruiting body veil 119.54 71.13 167.96

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.736474 no
Casing YFB_stipe_center 0.484152 no
Casing YFB_stipe_shell 0.165164 no
Casing YFB_stipe_skin 0.202921 no
Casing YFB_cap_skin 0.009446 yes
Casing YFB_cap_tissue 0.236791 no
Casing YFB_gill_tissue 0.038278 yes
Casing YFB_veil 0.300784 no
Casing Initials 0.016104 yes
Casing Pileal_Stipeal_center 0.759435 no
Casing Pileal_Stipeal_shell 0.963537 no
Casing DIF_stipe_center 0.587462 no
Casing DIF_stipe_shell 0.195079 no
Casing DIF_stipe_skin 0.274857 no
Casing DIF_cap_skin 0.039390 yes
Casing DIF_cap_tissue 0.525705 no
DIF_gill_tissue YFB_stipe_center 0.156118 no
DIF_gill_tissue YFB_stipe_shell 0.027698 yes
DIF_gill_tissue YFB_stipe_skin 0.040723 yes
DIF_gill_tissue YFB_cap_skin 0.001140 yes
DIF_gill_tissue YFB_cap_tissue 0.047584 yes
DIF_gill_tissue YFB_gill_tissue 0.002951 yes
DIF_gill_tissue YFB_veil 0.072330 no
YFB_stipe_center YFB_stipe_shell 0.660639 no
YFB_stipe_center YFB_stipe_skin 0.734118 no
YFB_stipe_center YFB_cap_skin 0.098442 no
YFB_stipe_center YFB_cap_tissue 0.785020 no
YFB_stipe_center YFB_gill_tissue 0.266541 no
YFB_stipe_center YFB_veil 0.865737 no
YFB_stipe_shell YFB_stipe_skin 0.951369 no
YFB_stipe_shell YFB_cap_skin 0.397993 no
YFB_stipe_shell YFB_cap_tissue 0.917111 no
YFB_stipe_shell YFB_gill_tissue 0.676018 no
YFB_stipe_shell YFB_veil 0.849063 no
YFB_stipe_skin YFB_cap_skin 0.321090 no
YFB_stipe_skin YFB_cap_tissue 0.969772 no
YFB_stipe_skin YFB_gill_tissue 0.586122 no
YFB_stipe_skin YFB_veil 0.908592 no
YFB_cap_skin YFB_cap_tissue 0.271655 no
YFB_cap_skin YFB_gill_tissue 0.812678 no
YFB_cap_skin YFB_veil 0.204111 no
YFB_cap_tissue YFB_gill_tissue 0.533287 no
YFB_cap_tissue YFB_veil 0.943077 no
YFB_gill_tissue YFB_veil 0.437868 no
Initials DIF_gill_tissue 0.054776 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.002525 yes
Initials Pileal_Stipeal_shell 0.008457 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.377517 no
Pileal_Stipeal_center YFB_stipe_center 0.789696 no
Pileal_Stipeal_center YFB_stipe_shell 0.388159 no
Pileal_Stipeal_center YFB_stipe_skin 0.450593 no
Pileal_Stipeal_center YFB_cap_skin 0.029408 yes
Pileal_Stipeal_center YFB_cap_tissue 0.501943 no
Pileal_Stipeal_center YFB_gill_tissue 0.110551 no
Pileal_Stipeal_center YFB_veil 0.596917 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.799163 no
Pileal_Stipeal_center DIF_stipe_center 0.890586 no
Pileal_Stipeal_center DIF_stipe_shell 0.432334 no
Pileal_Stipeal_center DIF_stipe_skin 0.562908 no
Pileal_Stipeal_center DIF_cap_skin 0.120821 no
Pileal_Stipeal_center DIF_cap_tissue 0.832596 no
Pileal_Stipeal_shell DIF_gill_tissue 0.652408 no
Pileal_Stipeal_shell YFB_stipe_center 0.514681 no
Pileal_Stipeal_shell YFB_stipe_shell 0.170099 no
Pileal_Stipeal_shell YFB_stipe_skin 0.211699 no
Pileal_Stipeal_shell YFB_cap_skin 0.007439 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.246193 no
Pileal_Stipeal_shell YFB_gill_tissue 0.033211 yes
Pileal_Stipeal_shell YFB_veil 0.315328 no
Pileal_Stipeal_shell DIF_stipe_center 0.630510 no
Pileal_Stipeal_shell DIF_stipe_shell 0.199377 no
Pileal_Stipeal_shell DIF_stipe_skin 0.292037 no
Pileal_Stipeal_shell DIF_cap_skin 0.034837 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.560412 no
DIF_stipe_center DIF_gill_tissue 0.227368 no
DIF_stipe_center YFB_stipe_center 0.925312 no
DIF_stipe_center YFB_stipe_shell 0.532615 no
DIF_stipe_center YFB_stipe_skin 0.610165 no
DIF_stipe_center YFB_cap_skin 0.057550 no
DIF_stipe_center YFB_cap_tissue 0.662908 no
DIF_stipe_center YFB_gill_tissue 0.182315 no
DIF_stipe_center YFB_veil 0.755464 no
DIF_stipe_center DIF_stipe_shell 0.590931 no
DIF_stipe_center DIF_stipe_skin 0.723458 no
DIF_stipe_center DIF_cap_skin 0.193249 no
DIF_stipe_center DIF_cap_tissue 0.955931 no
DIF_stipe_shell DIF_gill_tissue 0.032504 yes
DIF_stipe_shell YFB_stipe_center 0.717354 no
DIF_stipe_shell YFB_stipe_shell 0.963374 no
DIF_stipe_shell YFB_stipe_skin 0.989611 no
DIF_stipe_shell YFB_cap_skin 0.332715 no
DIF_stipe_shell YFB_cap_tissue 0.959551 no
DIF_stipe_shell YFB_gill_tissue 0.603614 no
DIF_stipe_shell YFB_veil 0.895917 no
DIF_stipe_shell DIF_stipe_skin 0.918848 no
DIF_stipe_shell DIF_cap_skin 0.630458 no
DIF_stipe_shell DIF_cap_tissue 0.673436 no
DIF_stipe_skin DIF_gill_tissue 0.064141 no
DIF_stipe_skin YFB_stipe_center 0.837211 no
DIF_stipe_skin YFB_stipe_shell 0.878362 no
DIF_stipe_skin YFB_stipe_skin 0.932455 no
DIF_stipe_skin YFB_cap_skin 0.230137 no
DIF_stipe_skin YFB_cap_tissue 0.963904 no
DIF_stipe_skin YFB_gill_tissue 0.474406 no
DIF_stipe_skin YFB_veil 0.980405 no
DIF_stipe_skin DIF_cap_skin 0.500546 no
DIF_stipe_skin DIF_cap_tissue 0.801507 no
DIF_cap_skin DIF_gill_tissue 0.003765 yes
DIF_cap_skin YFB_stipe_center 0.283853 no
DIF_cap_skin YFB_stipe_shell 0.703924 no
DIF_cap_skin YFB_stipe_skin 0.616889 no
DIF_cap_skin YFB_cap_skin 0.785531 no
DIF_cap_skin YFB_cap_tissue 0.564974 no
DIF_cap_skin YFB_gill_tissue 0.983256 no
DIF_cap_skin YFB_veil 0.464428 no
DIF_cap_skin DIF_cap_tissue 0.250684 no
DIF_cap_tissue DIF_gill_tissue 0.183946 no
DIF_cap_tissue YFB_stipe_center 0.972599 no
DIF_cap_tissue YFB_stipe_shell 0.613707 no
DIF_cap_tissue YFB_stipe_skin 0.688749 no
DIF_cap_tissue YFB_cap_skin 0.081058 no
DIF_cap_tissue YFB_cap_tissue 0.738373 no
DIF_cap_tissue YFB_gill_tissue 0.232528 no
DIF_cap_tissue YFB_veil 0.827012 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101920
MHQLFPTRREFALVLLFLLLLVLLNRGPGTSYPPNVPSSSRRHTLQAEQPALPQTQLSWKNNPVPQTKLVAHVPG
WTVFDRLYVFKGVVYIVSDDEGSLPHVQFILSRGIRIENGQEAELGRLPTDEDIRIISTEEARRLFGVGASILDG
VTLFVNDPHQFITHYYHWSAELWFGFWRTYSTLDTTITSDGNTTLPFTRRIMFNHLDAHHWRDYAHMNEWVVRSS
FPSATMEFMDDWRDRAELGKPFVFDRIVIADRSAAMRSYNFQRYQRTASAAFALPGSVNWWMPIRNNVIKFAGLD
SNTGGGTTGAPVITYISRQQWGRRMLIPEHHEELVHELHKLRDVYGYEVNIVEAENMSRVEQIRLAARTTIMMGV
HGNGLTSLVWMKPNPRSTVMEFFYPQGFAHDYEFTTRALGMTHYGFWGNQSFTSPDLPLPQYVEGFQGNSIPIDA
EAVARLCVERLSLNFEVDD*
Coding >AgabiH97|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCCTCTTCCAGTCGACGACATACACTCCAGGCAGAACAGCCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGC
TGGACAGTTTTCGACAGACTATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCG
CACGTCCAGTTTATCCTCTCAAGAGGCATTCGAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACG
GACGAAGATATCCGTATTATCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGT
GTCACTCTTTTCGTCAATGACCCTCATCAATTCATCACTCACTATTACCACTGGTCGGCCGAACTCTGGTTTGGC
TTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATTTACACGGCGC
ATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGTCCGCTCCTCT
TTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATTTGTTTTTGAT
CGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGACTGCTTCTGCT
GCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGCGGGGTTAGAC
TCCAACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACTTATATCTCTAGGCAACAATGGGGAAGACGCATG
TTGATTCCAGAACACCACGAGGAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTATGAAGTCAAC
ATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTATAATGATGGGAGTC
CATGGAAATGGTTTGACTTCTCTCGTCTGGATGAAACCAAACCCTCGTTCCACCGTTATGGAGTTCTTTTACCCC
CAAGGCTTCGCACATGACTATGAATTTACTACTCGAGCACTTGGAATGACACATTATGGCTTCTGGGGCAATCAG
TCTTTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCA
GAGGCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA
Transcript >AgabiH97|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCCTCTTCCAGTCGACGACATACACTCCAGGCAGAACAGCCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGC
TGGACAGTTTTCGACAGACTATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCG
CACGTCCAGTTTATCCTCTCAAGAGGCATTCGAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACG
GACGAAGATATCCGTATTATCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGT
GTCACTCTTTTCGTCAATGACCCTCATCAATTCATCACTCACTATTACCACTGGTCGGCCGAACTCTGGTTTGGC
TTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATTTACACGGCGC
ATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGTCCGCTCCTCT
TTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATTTGTTTTTGAT
CGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGACTGCTTCTGCT
GCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGCGGGGTTAGAC
TCCAACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACTTATATCTCTAGGCAACAATGGGGAAGACGCATG
TTGATTCCAGAACACCACGAGGAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTATGAAGTCAAC
ATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTATAATGATGGGAGTC
CATGGAAATGGTTTGACTTCTCTCGTCTGGATGAAACCAAACCCTCGTTCCACCGTTATGGAGTTCTTTTACCCC
CAAGGCTTCGCACATGACTATGAATTTACTACTCGAGCACTTGGAATGACACATTATGGCTTCTGGGGCAATCAG
TCTTTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCA
GAGGCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA
Gene >AgabiH97|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCCTCTTCCAGTCGACGACATACACTCCAGGCAGAACAGCCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGT
ATGTCCCAGCTTCTCGTACTCTCGCGTGCCACTCTTCATTCGCACCGTGTTCAGGCTGGACAGTTTTCGACAGAC
TATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCGCACGTCCAGTTTATCCTCT
CAAGAGGCATTCGAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACGGACGAAGATATCCGTATTA
TCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGTGTCACTGTATGTCGGTCGC
TTTCTCGCACCTTTCCTCCTTGACAATTTATCACTAGCTTTTCGTCAATGACCCTCATCAATTGTATGGTTCCTC
CTCTACAACGTTCCCATGATGTCTAAACTCTTTCCTTCGCAGCATCACTCACTATTACCACTGGTCGGCCGAACT
CTGGTTTGGCTTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATT
TACACGGCGCATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGT
CCGCTCCTCTTTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATT
TGTTTTTGATCGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGAC
TGCTTCTGCTGCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGC
GGGGTTAGACTCCAACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACTTATATCTCTAGGCAACAATGGGG
AAGACGCATGTTGATTCCAGAACACCACGAGGAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTA
TGAAGTCAACATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTGTACG
TCTACTGCCGCTTCTTTTCTCTTCGGAGAAGGTTTTTCGCTGATCTGACGCCACATCTATCTAATTACCTAGATA
ATGATGGGAGTCCATGGAAATGGTTTGACTTCTCTCGTCTGGATGAAACCAAACCCTCGTTCCACCGTTATGGAG
TTCTTTTACCCCCAAGGCTTCGCACATGACTATGAATTTACTACTCGAGCACTTGGAATGACACATTATGGCTTC
TGGGGCAATCAGTACGTTTTCCGAACGACTATCAATATTATCCCATTTCATATTTTTCTCTTGATTTCCAGGTCT
TTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCAGAG
GCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail