Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101910
Gene name
Locationscaffold_7:1205844..1208741
Strand+
Gene length (bp)2897
Transcript length (bp)2481
Coding sequence length (bp)2481
Protein length (aa) 827

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 4.3E-36 707 820
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 1.0E-31 575 698

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3LSS0|C19L2_DANRE CWF19-like protein 2 OS=Danio rerio GN=cwf19l2 PE=2 SV=1 325 820 7.0E-67
sp|Q09909|CWF19_SCHPO Pre-mRNA-splicing factor cwf19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf19 PE=1 SV=1 237 824 6.0E-63
sp|Q28C44|C19L2_XENTR CWF19-like protein 2 OS=Xenopus tropicalis GN=cwf19l2 PE=2 SV=1 387 820 8.0E-63
sp|Q2TBE0|C19L2_HUMAN CWF19-like protein 2 OS=Homo sapiens GN=CWF19L2 PE=1 SV=4 329 820 2.0E-61
sp|Q8BG79|C19L2_MOUSE CWF19-like protein 2 OS=Mus musculus GN=Cwf19l2 PE=1 SV=1 408 820 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3LSS0|C19L2_DANRE CWF19-like protein 2 OS=Danio rerio GN=cwf19l2 PE=2 SV=1 325 820 7.0E-67
sp|Q09909|CWF19_SCHPO Pre-mRNA-splicing factor cwf19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf19 PE=1 SV=1 237 824 6.0E-63
sp|Q28C44|C19L2_XENTR CWF19-like protein 2 OS=Xenopus tropicalis GN=cwf19l2 PE=2 SV=1 387 820 8.0E-63
sp|Q2TBE0|C19L2_HUMAN CWF19-like protein 2 OS=Homo sapiens GN=CWF19L2 PE=1 SV=4 329 820 2.0E-61
sp|Q8BG79|C19L2_MOUSE CWF19-like protein 2 OS=Mus musculus GN=Cwf19l2 PE=1 SV=1 408 820 3.0E-59
sp|Q9VXT5|C19L2_DROME CWF19-like protein 2 homolog OS=Drosophila melanogaster GN=CG9213 PE=1 SV=2 402 820 9.0E-49
sp|Q10946|C19L2_CAEEL CWF19-like protein 2 homolog OS=Caenorhabditis elegans GN=B0361.2/B0361.1 PE=3 SV=2 391 820 2.0E-40
sp|Q84WU9|C3H64_ARATH Zinc finger CCCH domain-containing protein 64 OS=Arabidopsis thaliana GN=At5g56900 PE=2 SV=1 586 818 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101910
MDSHEREQKHRSSRHEEKEKERPKHRSHGKDRDRDDRKHKKRRTHDDEHEGQERKHKHRKKEKGGKEVHLAVVDD
DVNDEDMWVEKNIDMEGERVLTTDIPTAESLNIVSTAEDHPSDPSLPRATAATSQLKRDEWMLLPPSIPAFPNAS
SELQLPLQTNNETLTEGYGDVPPNKRTMSEGLDFFSSLGTEHKKKQPDKPDPDKPKVSYRELNPEIISGKPTNSD
EPPPPPKPNVPGGPGSPWRMMRLRKVYETAEEDNRPLEEVAMERFGSLALFEEAKEERRILDERGGKKADRDRER
GRKNGQAEIGFGGEKKLMFTDIGGSGTSSRSSSFRRPGAMGESTPSTPSPPTGTAPVNRRLDSLRLPSQASSPLA
QSHTPIPSVMTPPPPVASGSSSAGRPLSPSSLNKLQAKVLRAKLMGAPDAEKLEKEYDMEIKRTHGSQDESGVRT
KVEAMPTLDARGRLYDVGHGGEDDRRPAGNKRKKEEKFETHDRKTGEIIRYNADDDTMTLGEMLRQEKFEAGMAD
QKDLDAQFAKAIMGDTKFENDLEYMDDNAAKLGRQKMRSDAMKRQFAIHDYKRTQQVLATCPFCYGEDDSLPKAP
IVAMGTRTYLSCTTFEELVKGHCLIVPIQHHLSMLEADDDTWDEVRNFMKCLMRMFAEDDKGVIFYETIISLKWQ
KHTFVECVPLPWDQFDLIPGYFKESILTSEAEWSQHKKLIDFSSRPGGFRRAMVPNLPYFMVQFDYKGEKGYGHV
IEGTGKDMDEELDEGEKGGGEFPRYFAGEIIGNLLDLEPRRWRRPRKVDFRSNKERVKSFKKEYEKFDWTGMIER
Q*
Coding >AgabiH97|101910
ATGGACAGCCACGAACGAGAGCAAAAACATAGGTCTTCGAGACACGAAGAGAAAGAGAAGGAACGGCCTAAACAC
CGGTCCCATGGCAAGGATAGGGATAGGGATGACCGCAAACACAAGAAACGGAGGACACATGACGATGAACATGAA
GGACAAGAGCGGAAACATAAACACAGGAAAAAGGAAAAAGGCGGCAAGGAAGTCCATCTTGCCGTTGTGGATGAT
GATGTCAATGATGAAGATATGTGGGTGGAGAAGAACATTGACATGGAGGGTGAACGAGTCCTCACGACAGACATT
CCTACAGCAGAAAGCCTAAATATTGTTTCCACTGCAGAAGACCATCCATCAGATCCAAGTTTACCCAGAGCGACT
GCAGCTACGTCGCAATTGAAGCGCGACGAGTGGATGTTACTTCCACCTAGCATACCTGCTTTTCCAAACGCATCT
TCCGAACTCCAACTCCCACTACAGACGAACAACGAAACTTTAACTGAGGGTTACGGCGACGTCCCTCCAAATAAA
CGAACAATGAGTGAAGGCCTTGATTTCTTTTCAAGTCTTGGTACCGAACATAAGAAAAAACAACCAGATAAGCCA
GACCCCGACAAGCCCAAAGTAAGTTACCGCGAACTCAATCCAGAAATCATATCTGGCAAACCAACAAACTCCGAC
GAACCACCTCCACCACCCAAACCCAATGTCCCTGGCGGTCCCGGATCCCCCTGGCGTATGATGCGTCTCCGCAAA
GTATATGAAACCGCGGAGGAAGACAATCGACCTCTGGAGGAAGTCGCCATGGAACGCTTCGGTTCTCTTGCTCTA
TTCGAAGAAGCCAAAGAGGAGCGTCGGATATTGGATGAGAGGGGTGGAAAAAAAGCCGATCGCGACCGCGAGAGA
GGGAGAAAAAATGGACAGGCGGAAATTGGATTTGGTGGGGAAAAGAAATTAATGTTCACTGATATAGGTGGAAGT
GGCACTTCGAGTCGTAGCTCTTCGTTCCGCCGGCCTGGGGCTATGGGGGAAAGTACGCCTTCGACACCTTCACCA
CCGACAGGTACCGCACCTGTCAATCGTCGTTTGGACTCTCTACGGTTGCCGTCGCAGGCCAGTTCACCGCTTGCA
CAATCACATACCCCCATTCCATCAGTCATGACGCCACCTCCGCCCGTTGCGTCTGGGTCTAGTTCTGCTGGGCGG
CCATTGTCACCTTCATCCTTGAACAAGCTTCAAGCAAAGGTGTTACGGGCAAAGCTTATGGGCGCCCCTGATGCG
GAAAAGTTGGAAAAAGAGTATGACATGGAGATTAAGAGGACTCATGGCAGTCAAGATGAAAGTGGTGTGCGGACG
AAGGTAGAAGCTATGCCAACTTTGGATGCAAGGGGACGGTTGTATGACGTTGGCCATGGCGGAGAAGATGACCGG
CGACCGGCAGGCAATAAGAGGAAGAAGGAAGAAAAGTTTGAAACTCATGATCGTAAAACTGGCGAAATCATTCGT
TATAATGCTGATGATGACACGATGACACTGGGCGAGATGCTACGACAAGAAAAATTCGAAGCTGGGATGGCTGAT
CAAAAAGACTTGGATGCTCAGTTCGCGAAGGCCATTATGGGTGATACAAAGTTTGAGAATGACCTCGAATATATG
GACGATAATGCAGCCAAGTTGGGTCGTCAGAAAATGCGTTCGGATGCAATGAAACGACAGTTCGCTATCCATGAT
TATAAACGCACCCAACAGGTGCTTGCCACATGTCCATTCTGTTATGGGGAAGATGATTCGCTACCAAAAGCTCCG
ATCGTTGCAATGGGCACGCGGACCTATCTCTCGTGCACAACCTTTGAAGAACTTGTCAAGGGACACTGCCTAATT
GTTCCAATTCAACATCACCTTAGTATGCTAGAGGCTGATGATGATACCTGGGACGAAGTCAGGAACTTTATGAAA
TGCCTGATGCGTATGTTTGCCGAGGACGATAAAGGCGTCATCTTCTACGAAACCATTATTTCCTTGAAATGGCAG
AAACACACATTCGTGGAGTGCGTACCCTTGCCCTGGGACCAGTTCGATTTGATACCAGGCTACTTCAAGGAATCC
ATTTTGACTTCAGAAGCTGAGTGGTCACAGCACAAGAAGCTGATTGACTTTTCTTCTCGCCCGGGAGGATTTCGG
CGTGCCATGGTTCCGAACCTGCCCTATTTCATGGTGCAATTTGACTACAAGGGTGAGAAGGGTTATGGCCACGTT
ATTGAAGGGACTGGCAAAGATATGGACGAGGAGCTCGACGAAGGCGAGAAGGGAGGTGGCGAATTCCCAAGGTAC
TTTGCTGGTGAAATTATTGGGAATCTGTTGGATTTGGAGCCGAGACGGTGGAGACGGCCAAGGAAGGTGGATTTC
AGGAGCAACAAGGAGCGGGTGAAGTCGTTCAAGAAGGAGTACGAGAAGTTTGACTGGACTGGTATGATAGAGCGG
CAGTGA
Transcript >AgabiH97|101910
ATGGACAGCCACGAACGAGAGCAAAAACATAGGTCTTCGAGACACGAAGAGAAAGAGAAGGAACGGCCTAAACAC
CGGTCCCATGGCAAGGATAGGGATAGGGATGACCGCAAACACAAGAAACGGAGGACACATGACGATGAACATGAA
GGACAAGAGCGGAAACATAAACACAGGAAAAAGGAAAAAGGCGGCAAGGAAGTCCATCTTGCCGTTGTGGATGAT
GATGTCAATGATGAAGATATGTGGGTGGAGAAGAACATTGACATGGAGGGTGAACGAGTCCTCACGACAGACATT
CCTACAGCAGAAAGCCTAAATATTGTTTCCACTGCAGAAGACCATCCATCAGATCCAAGTTTACCCAGAGCGACT
GCAGCTACGTCGCAATTGAAGCGCGACGAGTGGATGTTACTTCCACCTAGCATACCTGCTTTTCCAAACGCATCT
TCCGAACTCCAACTCCCACTACAGACGAACAACGAAACTTTAACTGAGGGTTACGGCGACGTCCCTCCAAATAAA
CGAACAATGAGTGAAGGCCTTGATTTCTTTTCAAGTCTTGGTACCGAACATAAGAAAAAACAACCAGATAAGCCA
GACCCCGACAAGCCCAAAGTAAGTTACCGCGAACTCAATCCAGAAATCATATCTGGCAAACCAACAAACTCCGAC
GAACCACCTCCACCACCCAAACCCAATGTCCCTGGCGGTCCCGGATCCCCCTGGCGTATGATGCGTCTCCGCAAA
GTATATGAAACCGCGGAGGAAGACAATCGACCTCTGGAGGAAGTCGCCATGGAACGCTTCGGTTCTCTTGCTCTA
TTCGAAGAAGCCAAAGAGGAGCGTCGGATATTGGATGAGAGGGGTGGAAAAAAAGCCGATCGCGACCGCGAGAGA
GGGAGAAAAAATGGACAGGCGGAAATTGGATTTGGTGGGGAAAAGAAATTAATGTTCACTGATATAGGTGGAAGT
GGCACTTCGAGTCGTAGCTCTTCGTTCCGCCGGCCTGGGGCTATGGGGGAAAGTACGCCTTCGACACCTTCACCA
CCGACAGGTACCGCACCTGTCAATCGTCGTTTGGACTCTCTACGGTTGCCGTCGCAGGCCAGTTCACCGCTTGCA
CAATCACATACCCCCATTCCATCAGTCATGACGCCACCTCCGCCCGTTGCGTCTGGGTCTAGTTCTGCTGGGCGG
CCATTGTCACCTTCATCCTTGAACAAGCTTCAAGCAAAGGTGTTACGGGCAAAGCTTATGGGCGCCCCTGATGCG
GAAAAGTTGGAAAAAGAGTATGACATGGAGATTAAGAGGACTCATGGCAGTCAAGATGAAAGTGGTGTGCGGACG
AAGGTAGAAGCTATGCCAACTTTGGATGCAAGGGGACGGTTGTATGACGTTGGCCATGGCGGAGAAGATGACCGG
CGACCGGCAGGCAATAAGAGGAAGAAGGAAGAAAAGTTTGAAACTCATGATCGTAAAACTGGCGAAATCATTCGT
TATAATGCTGATGATGACACGATGACACTGGGCGAGATGCTACGACAAGAAAAATTCGAAGCTGGGATGGCTGAT
CAAAAAGACTTGGATGCTCAGTTCGCGAAGGCCATTATGGGTGATACAAAGTTTGAGAATGACCTCGAATATATG
GACGATAATGCAGCCAAGTTGGGTCGTCAGAAAATGCGTTCGGATGCAATGAAACGACAGTTCGCTATCCATGAT
TATAAACGCACCCAACAGGTGCTTGCCACATGTCCATTCTGTTATGGGGAAGATGATTCGCTACCAAAAGCTCCG
ATCGTTGCAATGGGCACGCGGACCTATCTCTCGTGCACAACCTTTGAAGAACTTGTCAAGGGACACTGCCTAATT
GTTCCAATTCAACATCACCTTAGTATGCTAGAGGCTGATGATGATACCTGGGACGAAGTCAGGAACTTTATGAAA
TGCCTGATGCGTATGTTTGCCGAGGACGATAAAGGCGTCATCTTCTACGAAACCATTATTTCCTTGAAATGGCAG
AAACACACATTCGTGGAGTGCGTACCCTTGCCCTGGGACCAGTTCGATTTGATACCAGGCTACTTCAAGGAATCC
ATTTTGACTTCAGAAGCTGAGTGGTCACAGCACAAGAAGCTGATTGACTTTTCTTCTCGCCCGGGAGGATTTCGG
CGTGCCATGGTTCCGAACCTGCCCTATTTCATGGTGCAATTTGACTACAAGGGTGAGAAGGGTTATGGCCACGTT
ATTGAAGGGACTGGCAAAGATATGGACGAGGAGCTCGACGAAGGCGAGAAGGGAGGTGGCGAATTCCCAAGGTAC
TTTGCTGGTGAAATTATTGGGAATCTGTTGGATTTGGAGCCGAGACGGTGGAGACGGCCAAGGAAGGTGGATTTC
AGGAGCAACAAGGAGCGGGTGAAGTCGTTCAAGAAGGAGTACGAGAAGTTTGACTGGACTGGTATGATAGAGCGG
CAGTGA
Gene >AgabiH97|101910
ATGGACAGCCACGAACGAGAGCAAAAACATAGGTCTTCGAGACACGAAGAGAAAGAGAAGGAACGGCCTAAACAC
CGGTCCCATGGCAAGGATAGGGATAGGGATGACCGCAAACACAAGAAACGGAGGACACATGACGATGAACATGAA
GGACAAGAGCGGAAACATAAACACAGGAAAAAGGAAAAAGGCGGCAAGGAAGTCCATCTTGCCGTTGTGGATGAT
GATGTCAATGATGAAGATATGTGGGTGGAGAAGAACATTGACATGGAGGGTGAACGAGTGCGTATTCACAATTAC
TATCCATCCATGTATTCTTCAACTGGTACCAAATAATAGGTCCTCACGACAGACATTCCTACAGCAGAAAGCCTA
AATATTGTTTCCACTGCAGAAGACCATCCATCAGATCCAAGTTTACCCAGAGCGACTGCAGCTACGTCGCAATTG
AAGCGCGACGAGTGGATGTTACTTCCACCTAGCATACCTGCTTTTCCAAACGCATCTTCCGAACTCCAACTCCCA
CTACAGACGAACAACGAAACTTTAACTGAGGGTTACGGCGACGTCCCTCCAAATAAACGAACAATGAGTGAAGGC
CTTGATTTCTTTTCAAGTCTTGGTACCGAACATAAGAAAAAACAACCAGATAAGCCAGACCCCGACAAGGTATCT
CGCATTGTAATTCCTCGAGAAATATCCATGCTCATGCACCAACACCAGCCCAAAGTAAGTTACCGCGAACTCAAT
CCAGAAATCATATCTGGCAAACCAACAAACTCCGACGAACCACCTCCACCACCCAAACCCAATGTCCCTGGCGGT
CCCGGATCCCCCTGGCGTATGATGCGTCTCCGCAAAGTATATGAAACCGCGGAGGAAGACAATCGACCTCTGGAG
GAAGTCGCCATGGAACGCTTCGGTTCTCTTGCTCTATTCGAAGAAGCCAAAGAGGAGCGTCGGATATTGGATGAG
AGGGGTGGAAAAAAAGCCGATCGCGACCGCGAGAGAGGGAGAAAAAATGGACAGGCGGAAATTGGATTTGGTGGG
GAAAAGAAATTAATGTTCACTGATATAGGTGGAAGTGGCACTTCGAGTCGTAGCTCTTCGTTCCGCCGGCCTGGG
GCTATGGGGGAAAGTACGCCTTCGACACCTTCACCACCGACAGGTACCGCACCTGTCAATCGTCGTTTGGACTCT
CTACGGTTGCCGTCGCAGGCCAGTTCACCGCTTGCACAATCACATACCCCCATTCCATCAGTCATGACGCCACCT
CCGCCCGTTGCGTCTGGGTCTAGTTCTGCTGGGCGGCCATTGTCACCTTCATCCTTGAACAAGCTTCAAGCAAAG
GTGTTACGGGCAAAGCTTATGGGCGCCCCTGATGCGGAAAAGTTGGAAAAAGAGTATGACATGGAGATTAAGAGG
ACTCATGGCAGTCAAGATGAAAGTGGTGTGCGGACGAAGGTAGAAGCTATGCCAACTTTGGATGCAAGGGGACGG
TTGTATGACGTTGGCCATGGCGGAGAAGATGACCGGCGACCGGCAGGCAATAAGAGGAAGAAGGAAGAAAAGGTG
AGTAGTTTGCAAGGTGCTAAATCTCACAGCCTATACTAATATCGTATTAGTTTGAAACTCATGATCGTAAAACTG
GCGAAATCATTCGTTATAATGCTGATGATGACACGATGACACTGGGCGAGATGCTACGACAAGAAAAATTCGAAG
CTGGGATGGCTGATCAAAAAGACTTGGATGCTCAGTTCGCGAAGGCCATTATGGGTGATACAAAGTTTGAGGTAT
GTACGAGTTTGATTCCCCAAATTCCTGCTCACTGAAGATGTCATAGAATGACCTCGAATATATGGACGATAATGC
AGCCAAGTTGGGTCGTCAGAAAATGCGTTCGGATGCAATGAAACGACAGTTCGCTATCCATGGTTTGGCACTTCA
CATTGATAATGAACAGGATTATGCTTACGCCGCTCTGTGCCAGATTATAAACGCACCCAACAGGTGCTTGCCACA
TGTCCATTCTGTTATGGGGAAGATGATTCGCTACCAAAAGCTCCGATCGTTGCAATGGGCACGCGGACCTATCTC
TCGTGCACAACCTTTGAAGAACTTGTCAAGGGACACTGCCTAATTGTTCCAATTCAACATCACCTTAGTATGCTA
GAGGCTGATGATGATACCTGGGACGAAGTCAGGGTGAGTAGGAGGCAACTTGATAAGCCTTGTGCTGGCTGACTG
GCTTTCAGAACTTTATGAAATGCCTGATGCGTATGTTTGCCGAGGACGATAAAGGCGTCATCTTCTACGAAACCA
TTATTTCCTTGAAATGGCAGAAACACACATTCGTGGAGTGCGTACCCTTGCCCTGGGACCAGTTCGATTTGATAC
CAGGCTACTTCAAGGTGCATTGCTTATTAGATGCTACACCTTTGACGCTCATGTGATTTTGTAGGAATCCATTTT
GACTTCAGAAGCTGAGTGGTCACAGCACAAGAAGCTGATTGACTTTTCTTCTCGCCCGGGAGGATTTCGGCGTGC
CATGGTTCCGAACCTGCCCTATTTCATGGTGCAATTTGACTACAAGGGTGAGAAGGGTTATGGCCACGTTATTGA
AGGGACTGGCAAAGATATGGACGAGGAGCTCGACGAAGGCGAGAAGGGAGGTGGCGAATTCCCAAGGTGTGTTGA
ACTATTTGCCAAGCGAGAGTATCTAACCTTGAAATAGGTACTTTGCTGGTGAAATTATTGGGAATCTGTTGGATT
TGGAGCCGAGACGGTGGAGACGGCCAAGGAAGGTGGATTTCAGGAGCAACAAGGAGCGGGTGAAGTCGTTCAAGA
AGGAGTACGAGAAGTTTGACTGGACTGGTATGATAGAGCGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail