Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101900
Gene name
Locationscaffold_7:1201823..1205640
Strand-
Gene length (bp)3817
Transcript length (bp)3180
Coding sequence length (bp)3180
Protein length (aa) 1060

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 3.3E-58 13 261
PF00679 EFG_C Elongation factor G C-terminus 1.4E-14 925 1004
PF14492 EFG_III Elongation Factor G, domain III 1.4E-08 624 692

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 9 1059 0.0E+00
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 13 1059 0.0E+00
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 13 1059 0.0E+00
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 9 458 3.0E-132
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 494 1059 3.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 9 1059 0.0E+00
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 13 1059 0.0E+00
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 13 1059 0.0E+00
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 9 458 3.0E-132
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 494 1059 3.0E-130
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 13 1006 6.0E-119
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 13 1006 7.0E-119
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 13 1012 2.0E-118
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 13 1012 1.0E-117
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 13 1006 8.0E-117
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 13 436 1.0E-76
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 11 436 5.0E-72
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 11 436 3.0E-68
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 11 436 2.0E-67
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 12 436 3.0E-67
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 12 430 3.0E-67
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 12 436 2.0E-66
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 13 436 9.0E-66
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 12 430 2.0E-65
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 13 436 5.0E-65
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 13 436 2.0E-64
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 13 430 2.0E-64
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 13 436 5.0E-64
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 12 430 9.0E-64
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 13 436 3.0E-63
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 13 436 4.0E-63
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 13 436 4.0E-63
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 13 430 5.0E-63
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 13 436 8.0E-60
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 13 436 9.0E-60
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 13 436 3.0E-59
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 13 436 3.0E-59
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 13 436 3.0E-59
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 13 436 3.0E-59
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 13 436 2.0E-58
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 481 1005 2.0E-56
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 498 1006 2.0E-56
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 498 1006 3.0E-56
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 498 1006 3.0E-56
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 498 1006 5.0E-56
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 498 1006 5.0E-56
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 498 1006 5.0E-56
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 498 1006 6.0E-56
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 498 1006 9.0E-56
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 481 1005 2.0E-53
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 498 1006 3.0E-52
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 498 1006 3.0E-52
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 498 1006 5.0E-52
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 498 1001 7.0E-52
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 498 998 1.0E-51
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 481 1015 1.0E-51
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 498 1015 2.0E-51
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 498 1004 5.0E-51
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 498 1041 1.0E-50
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 12 430 1.0E-49
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 498 1041 2.0E-49
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 498 1005 4.0E-49
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 498 1004 8.0E-48
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 498 1004 8.0E-48
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 498 1006 1.0E-47
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 4 274 4.0E-44
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 4 274 5.0E-44
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 9 181 3.0E-43
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 3 194 4.0E-43
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 498 1041 7.0E-43
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 511 1050 8.0E-43
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 511 1050 8.0E-43
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 511 1050 8.0E-43
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 511 1050 9.0E-43
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 4 270 1.0E-42
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 511 1050 8.0E-42
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 9 278 9.0E-42
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 13 254 2.0E-41
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 4 262 3.0E-41
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 14 388 4.0E-41
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 14 388 6.0E-41
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 14 388 6.0E-41
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 14 388 6.0E-41
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 14 388 6.0E-41
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 14 254 2.0E-40
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 511 1054 5.0E-40
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 13 380 1.0E-39
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 10 197 1.0E-39
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 11 181 5.0E-39
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 13 178 6.0E-39
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 1 274 1.0E-38
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 1 274 1.0E-38
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 1 274 1.0E-38
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 10 196 1.0E-38
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 1 274 1.0E-38
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 10 197 1.0E-38
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 1 274 4.0E-38
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 11 254 1.0E-37
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 10 254 1.0E-37
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 10 254 1.0E-37
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 10 181 2.0E-37
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 11 181 2.0E-37
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 11 181 7.0E-37
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 13 254 7.0E-37
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 11 199 8.0E-37
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 11 178 8.0E-37
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 11 178 9.0E-37
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 11 178 9.0E-37
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 11 181 9.0E-37
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 11 181 1.0E-36
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 11 181 2.0E-36
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 11 184 2.0E-36
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 11 178 3.0E-35
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 14 181 6.0E-35
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 6 181 6.0E-35
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 6 181 7.0E-35
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 14 181 1.0E-34
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 14 181 1.0E-34
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 4 186 2.0E-34
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 14 181 2.0E-34
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 14 269 2.0E-34
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 14 181 3.0E-34
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 6 181 3.0E-34
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 5 184 1.0E-33
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 9 184 2.0E-33
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 12 182 2.0E-33
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 21 269 6.0E-33
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 9 184 9.0E-33
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 9 184 1.0E-32
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 11 269 1.0E-32
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 1 197 3.0E-32
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 512 995 7.0E-32
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 473 1001 1.0E-31
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 11 184 2.0E-31
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 11 194 4.0E-31
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 11 192 9.0E-31
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 558 999 2.0E-28
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 509 1041 4.0E-28
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 11 181 5.0E-28
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 510 1004 3.0E-25
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 10 153 8.0E-25
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 12 154 2.0E-24
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 8 153 2.0E-24
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 8 153 2.0E-24
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 12 154 3.0E-24
sp|Q47RQ0|LEPA_THEFY Elongation factor 4 OS=Thermobifida fusca (strain YX) GN=lepA PE=3 SV=1 10 153 3.0E-24
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 13 182 6.0E-24
sp|A0JX50|LEPA_ARTS2 Elongation factor 4 OS=Arthrobacter sp. (strain FB24) GN=lepA PE=3 SV=1 8 153 6.0E-24
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 513 1001 7.0E-24
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 462 1018 1.0E-23
sp|Q8K9C8|TYPA_BUCAP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=typA PE=3 SV=1 12 154 1.0E-23
sp|C5CCD4|LEPA_MICLC Elongation factor 4 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lepA PE=3 SV=1 8 153 2.0E-23
sp|B8H8S3|LEPA_ARTCA Elongation factor 4 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=lepA PE=3 SV=1 8 153 2.0E-23
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 12 153 3.0E-23
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 12 153 3.0E-23
sp|B1VY28|LEPA_STRGG Elongation factor 4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lepA PE=3 SV=1 10 153 3.0E-23
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 12 153 3.0E-23
sp|B2GHU9|LEPA_KOCRD Elongation factor 4 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=lepA PE=3 SV=1 8 153 3.0E-23
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 12 153 3.0E-23
sp|Q6A9B2|LEPA_PROAC Elongation factor 4 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=lepA PE=3 SV=1 8 153 3.0E-23
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 12 153 5.0E-23
sp|Q7NAT2|LEPA_MYCGA Elongation factor 4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lepA PE=3 SV=2 10 153 5.0E-23
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 13 153 5.0E-23
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 509 1041 6.0E-23
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 12 153 6.0E-23
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 12 153 6.0E-23
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 12 153 7.0E-23
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 535 1001 1.0E-22
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 12 153 1.0E-22
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 11 153 1.0E-22
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 11 153 1.0E-22
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 14 154 1.0E-22
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 13 153 2.0E-22
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 14 153 2.0E-22
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 14 153 2.0E-22
sp|A1R6W8|LEPA_ARTAT Elongation factor 4 OS=Arthrobacter aurescens (strain TC1) GN=lepA PE=3 SV=1 8 153 2.0E-22
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 14 153 2.0E-22
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 13 153 2.0E-22
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 13 153 2.0E-22
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 13 153 2.0E-22
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 11 153 2.0E-22
sp|B9KD01|LEPA_CAMLR Elongation factor 4 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=lepA PE=3 SV=1 12 153 2.0E-22
sp|Q9ZHZ8|LEPA_MYCH2 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 232) GN=lepA PE=3 SV=3 10 153 3.0E-22
sp|A9RFQ5|GUFP_PHYPA Translation factor GUF1 homolog, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_158777 PE=3 SV=1 13 153 3.0E-22
sp|Q3ATB2|LEPA_CHLCH Elongation factor 4 OS=Chlorobium chlorochromatii (strain CaD3) GN=lepA PE=3 SV=1 8 153 3.0E-22
sp|Q4A8T9|LEPA_MYCH7 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 7448) GN=lepA PE=3 SV=1 10 153 3.0E-22
sp|Q4AAQ8|LEPA_MYCHJ Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lepA PE=3 SV=1 10 153 3.0E-22
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 12 153 3.0E-22
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 12 153 3.0E-22
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 10 153 3.0E-22
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 11 154 3.0E-22
sp|B0TW33|LEPA_FRAP2 Elongation factor 4 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lepA PE=3 SV=1 12 153 4.0E-22
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 1 153 4.0E-22
sp|Q9X1V8|LEPA_THEMA Elongation factor 4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lepA PE=3 SV=1 11 153 5.0E-22
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 14 153 5.0E-22
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 14 154 5.0E-22
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 10 153 5.0E-22
sp|Q8FNA3|LEPA_COREF Elongation factor 4 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lepA PE=3 SV=1 10 153 5.0E-22
sp|P60931|LEPA_CORDI Elongation factor 4 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=lepA PE=3 SV=1 10 153 5.0E-22
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 13 153 5.0E-22
sp|B2SEJ6|LEPA_FRATM Elongation factor 4 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lepA PE=3 SV=1 12 153 5.0E-22
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 10 153 6.0E-22
sp|Q0BP65|LEPA_FRATO Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|Q2A5X6|LEPA_FRATH Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|A7N9A4|LEPA_FRATF Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|A4J080|LEPA_FRATW Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|A0Q453|LEPA_FRATN Elongation factor 4 OS=Francisella tularensis subsp. novicida (strain U112) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 11 154 6.0E-22
sp|Q5NEF8|LEPA_FRATT Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|Q14FW1|LEPA_FRAT1 Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lepA PE=3 SV=1 12 153 6.0E-22
sp|Q6AEB5|LEPA_LEIXX Elongation factor 4 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=lepA PE=3 SV=1 8 153 6.0E-22
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 11 154 7.0E-22
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 10 153 7.0E-22
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 14 251 7.0E-22
sp|Q98QW3|LEPA_MYCPU Elongation factor 4 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lepA PE=3 SV=2 14 153 8.0E-22
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 14 153 9.0E-22
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 12 153 9.0E-22
sp|P57508|TYPA_BUCAI GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=typA PE=3 SV=1 12 155 9.0E-22
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 12 153 1.0E-21
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 6 153 1.0E-21
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 6 153 1.0E-21
sp|B9RHQ5|GUFP_RICCO Translation factor GUF1 homolog, chloroplastic OS=Ricinus communis GN=RCOM_1767360 PE=3 SV=1 13 153 1.0E-21
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 17 153 1.0E-21
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 6 153 1.0E-21
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 14 182 1.0E-21
sp|Q8NN68|LEPA_CORGL Elongation factor 4 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lepA PE=3 SV=1 10 153 1.0E-21
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 6 153 1.0E-21
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 8 153 1.0E-21
sp|Q4A5S3|LEPA_MYCS5 Elongation factor 4 OS=Mycoplasma synoviae (strain 53) GN=lepA PE=3 SV=1 14 153 1.0E-21
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 12 251 1.0E-21
sp|Q0VP16|LEPA_ALCBS Elongation factor 4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lepA PE=3 SV=1 10 153 1.0E-21
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 13 153 1.0E-21
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 12 154 1.0E-21
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 12 154 1.0E-21
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 12 154 1.0E-21
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 12 154 1.0E-21
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 12 154 1.0E-21
sp|C5BRN3|LEPA_TERTT Elongation factor 4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lepA PE=3 SV=1 10 153 1.0E-21
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 12 153 1.0E-21
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 462 1018 2.0E-21
sp|Q2SSF7|LEPA_MYCCT Elongation factor 4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lepA PE=3 SV=1 10 153 2.0E-21
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 13 153 2.0E-21
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 14 153 2.0E-21
sp|A1W018|LEPA_CAMJJ Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|Q9PNR1|LEPA_CAMJE Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|A8FM79|LEPA_CAMJ8 Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 10 153 2.0E-21
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 13 153 2.0E-21
sp|B9GHA6|GUFP_POPTR Translation factor GUF1 homolog, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_815670 PE=3 SV=2 12 153 2.0E-21
sp|A7H311|LEPA_CAMJD Elongation factor 4 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|Q7UX15|LEPA1_RHOBA Elongation factor 4 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA1 PE=3 SV=1 1 153 2.0E-21
sp|Q5HU70|LEPA_CAMJR Elongation factor 4 OS=Campylobacter jejuni (strain RM1221) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|Q89AC9|TYPA_BUCBP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=typA PE=3 SV=2 6 154 2.0E-21
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 11 153 2.0E-21
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|A5IYS0|LEPA_MYCAP Elongation factor 4 OS=Mycoplasma agalactiae (strain PG2) GN=lepA PE=3 SV=1 10 153 2.0E-21
sp|A5CWJ4|LEPA_VESOH Elongation factor 4 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 13 153 2.0E-21
sp|A5B4D2|GUFP_VITVI Translation factor GUF1 homolog, chloroplastic OS=Vitis vinifera GN=VITISV_013255 PE=3 SV=1 13 153 2.0E-21
sp|B3QZT9|LEPA_PHYMT Elongation factor 4 OS=Phytoplasma mali (strain AT) GN=lepA PE=3 SV=1 1 153 2.0E-21
sp|B4SBG4|LEPA_PELPB Elongation factor 4 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lepA PE=3 SV=1 6 153 2.0E-21
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 10 153 2.0E-21
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 20 153 2.0E-21
sp|Q49Y26|LEPA_STAS1 Elongation factor 4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lepA PE=3 SV=1 12 153 2.0E-21
sp|A7I1F0|LEPA_CAMHC Elongation factor 4 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lepA PE=3 SV=1 13 153 2.0E-21
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 13 153 2.0E-21
sp|Q72KV2|LEPA_THET2 Elongation factor 4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lepA PE=3 SV=1 10 153 2.0E-21
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 20 153 2.0E-21
sp|Q2JDK2|LEPA_FRASC Elongation factor 4 OS=Frankia sp. (strain CcI3) GN=lepA PE=3 SV=2 10 153 2.0E-21
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 462 1018 3.0E-21
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 509 1041 3.0E-21
sp|Q0SH84|LEPA_RHOJR Elongation factor 4 OS=Rhodococcus jostii (strain RHA1) GN=lepA PE=3 SV=1 10 153 3.0E-21
sp|A4SRD4|LEPA_AERS4 Elongation factor 4 OS=Aeromonas salmonicida (strain A449) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|A6WDJ3|LEPA_KINRD Elongation factor 4 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lepA PE=3 SV=1 14 153 3.0E-21
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 11 155 3.0E-21
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 9 154 3.0E-21
sp|Q492C9|LEPA_BLOPB Elongation factor 4 OS=Blochmannia pennsylvanicus (strain BPEN) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 6 153 3.0E-21
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 14 153 3.0E-21
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 13 153 3.0E-21
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 10 153 3.0E-21
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 12 153 3.0E-21
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 6 153 3.0E-21
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 6 153 3.0E-21
sp|A1AWP9|LEPA_RUTMC Elongation factor 4 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lepA PE=3 SV=1 12 153 4.0E-21
sp|C1AUN7|LEPA_RHOOB Elongation factor 4 OS=Rhodococcus opacus (strain B4) GN=lepA PE=3 SV=1 10 153 4.0E-21
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 14 153 4.0E-21
sp|Q8YU48|LEPA_NOSS1 Elongation factor 4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lepA PE=3 SV=1 14 153 4.0E-21
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 13 153 4.0E-21
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 13 153 4.0E-21
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 14 153 4.0E-21
sp|B9F2U5|GUFP_ORYSJ Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0157700 PE=3 SV=1 13 153 4.0E-21
sp|A8Z4C4|LEPA_STAAT Elongation factor 4 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|A6QHC7|LEPA_STAAE Elongation factor 4 OS=Staphylococcus aureus (strain Newman) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q5HFH6|LEPA_STAAC Elongation factor 4 OS=Staphylococcus aureus (strain COL) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q2FXY7|LEPA_STAA8 Elongation factor 4 OS=Staphylococcus aureus (strain NCTC 8325) GN=lepA PE=1 SV=1 13 153 5.0E-21
sp|Q2FGD9|LEPA_STAA3 Elongation factor 4 OS=Staphylococcus aureus (strain USA300) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q8NWA7|LEPA_STAAW Elongation factor 4 OS=Staphylococcus aureus (strain MW2) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q6G8Y3|LEPA_STAAS Elongation factor 4 OS=Staphylococcus aureus (strain MSSA476) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q6GGB6|LEPA_STAAR Elongation factor 4 OS=Staphylococcus aureus (strain MRSA252) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|P65272|LEPA_STAAN Elongation factor 4 OS=Staphylococcus aureus (strain N315) GN=lepA PE=1 SV=1 13 153 5.0E-21
sp|P65271|LEPA_STAAM Elongation factor 4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|Q2YT42|LEPA_STAAB Elongation factor 4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|A5ITB2|LEPA_STAA9 Elongation factor 4 OS=Staphylococcus aureus (strain JH9) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|A6U257|LEPA_STAA2 Elongation factor 4 OS=Staphylococcus aureus (strain JH1) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|A7X2Y7|LEPA_STAA1 Elongation factor 4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 14 153 5.0E-21
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 14 153 5.0E-21
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 13 153 5.0E-21
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 462 1018 6.0E-21
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 13 153 6.0E-21
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 12 153 6.0E-21
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 13 153 6.0E-21
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 13 153 6.0E-21
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 1 153 6.0E-21
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 14 153 6.0E-21
sp|Q9FNM5|GUFP_ARATH Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana GN=At5g08650 PE=2 SV=2 13 153 6.0E-21
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 11 318 7.0E-21
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 13 153 7.0E-21
sp|P46943|GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUF1 PE=1 SV=2 3 160 7.0E-21
sp|C8ZDQ3|GUF1_YEAS8 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GUF1 PE=3 SV=1 3 160 7.0E-21
sp|A7A1H2|GUF1_YEAS7 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=GUF1 PE=3 SV=1 3 160 7.0E-21
sp|B3RHG9|GUF1_YEAS1 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GUF1 PE=3 SV=1 3 160 7.0E-21
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 13 153 7.0E-21
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 10 153 7.0E-21
sp|Q83MZ5|LEPA_TROWT Elongation factor 4 OS=Tropheryma whipplei (strain Twist) GN=lepA PE=3 SV=1 11 198 7.0E-21
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 12 153 7.0E-21
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 460 989 8.0E-21
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 14 153 8.0E-21
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 13 153 8.0E-21
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 14 153 8.0E-21
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 13 153 8.0E-21
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 13 153 8.0E-21
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 8 153 8.0E-21
sp|Q83NI1|LEPA_TROW8 Elongation factor 4 OS=Tropheryma whipplei (strain TW08/27) GN=lepA PE=3 SV=1 11 198 8.0E-21
sp|Q2NJE6|LEPA_AYWBP Elongation factor 4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lepA PE=3 SV=1 12 153 8.0E-21
sp|P9WK97|LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lepA PE=1 SV=1 11 153 8.0E-21
sp|P9WK96|LEPA_MYCTO Elongation factor 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lepA PE=3 SV=1 11 153 8.0E-21
sp|A5U598|LEPA_MYCTA Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lepA PE=3 SV=1 11 153 8.0E-21
sp|C1AQW9|LEPA_MYCBT Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lepA PE=3 SV=1 11 153 8.0E-21
sp|A1KL96|LEPA_MYCBP Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lepA PE=3 SV=1 11 153 8.0E-21
sp|P65270|LEPA_MYCBO Elongation factor 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lepA PE=3 SV=1 11 153 8.0E-21
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 12 153 8.0E-21
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 10 153 8.0E-21
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 1 154 9.0E-21
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 3 153 9.0E-21
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 12 153 9.0E-21
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 13 153 9.0E-21
sp|Q8CP13|LEPA_STAES Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lepA PE=3 SV=1 13 153 9.0E-21
sp|Q5HNW2|LEPA_STAEQ Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lepA PE=3 SV=1 13 153 9.0E-21
sp|Q2GD00|LEPA_NEOSM Elongation factor 4 OS=Neorickettsia sennetsu (strain Miyayama) GN=lepA PE=3 SV=1 12 153 9.0E-21
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 12 153 9.0E-21
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 6 153 9.0E-21
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 2 153 9.0E-21
sp|Q31CB8|LEPA_PROM9 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=lepA PE=3 SV=1 14 153 1.0E-20
sp|A8G3D2|LEPA_PROM2 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9215) GN=lepA PE=3 SV=1 14 153 1.0E-20
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 9 160 1.0E-20
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 9 160 1.0E-20
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 9 160 1.0E-20
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 12 153 1.0E-20
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 3 160 1.0E-20
sp|A2BPP8|LEPA_PROMS Elongation factor 4 OS=Prochlorococcus marinus (strain AS9601) GN=lepA PE=3 SV=1 14 153 1.0E-20
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 6 153 1.0E-20
sp|A3PBD8|LEPA_PROM0 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9301) GN=lepA PE=3 SV=1 14 153 1.0E-20
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 12 153 1.0E-20
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 13 153 1.0E-20
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 6 153 1.0E-20
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 6 153 1.0E-20
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 12 153 1.0E-20
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 12 153 1.0E-20
sp|C3PHY1|LEPA_CORA7 Elongation factor 4 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=lepA PE=3 SV=1 10 182 1.0E-20
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 9 160 1.0E-20
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 5 153 1.0E-20
sp|B9DNK4|LEPA_STACT Elongation factor 4 OS=Staphylococcus carnosus (strain TM300) GN=lepA PE=3 SV=1 12 153 1.0E-20
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 9 153 1.0E-20
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 9 153 1.0E-20
sp|Q5FUC2|LEPA_GLUOX Elongation factor 4 OS=Gluconobacter oxydans (strain 621H) GN=lepA PE=3 SV=2 14 153 1.0E-20
sp|Q8D307|LEPA_WIGBR Elongation factor 4 OS=Wigglesworthia glossinidia brevipalpis GN=lepA PE=3 SV=1 13 153 1.0E-20
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 9 153 1.0E-20
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 14 153 1.0E-20
sp|Q8DM20|LEPA_THEEB Elongation factor 4 OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA PE=3 SV=1 13 153 1.0E-20
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 12 153 1.0E-20
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 11 154 1.0E-20
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 13 153 1.0E-20
sp|Q4JWS1|LEPA_CORJK Elongation factor 4 OS=Corynebacterium jeikeium (strain K411) GN=lepA PE=3 SV=1 10 153 1.0E-20
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 13 153 1.0E-20
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 14 153 1.0E-20
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 11 153 1.0E-20
sp|Q3J8D2|LEPA_NITOC Elongation factor 4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lepA PE=3 SV=1 8 153 1.0E-20
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 13 153 2.0E-20
sp|P74751|LEPA_SYNY3 Elongation factor 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 6 153 2.0E-20
sp|B1V9C5|LEPA_PHYAS Elongation factor 4 OS=Phytoplasma australiense GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 3 153 2.0E-20
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 13 153 2.0E-20
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 13 153 2.0E-20
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 13 153 2.0E-20
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|B2J0M4|LEPA_NOSP7 Elongation factor 4 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|B8BYH3|GUF1_THAPS Translation factor GUF1 homolog, mitochondrial OS=Thalassiosira pseudonana GN=THAPSDRAFT_40001 PE=3 SV=1 14 153 2.0E-20
sp|Q5SKA7|LEPA_THET8 Elongation factor 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lepA PE=1 SV=1 10 153 2.0E-20
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 10 153 2.0E-20
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 13 153 2.0E-20
sp|A0KGF0|LEPA_AERHH Elongation factor 4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 14 153 2.0E-20
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 6 153 2.0E-20
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 3 153 2.0E-20
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 12 153 2.0E-20
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 6 153 2.0E-20
sp|B5XNG8|LEPA_KLEP3 Elongation factor 4 OS=Klebsiella pneumoniae (strain 342) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 8 153 2.0E-20
sp|Q8GCP5|LEPA_MYCFP Elongation factor 4 OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lepA PE=3 SV=1 10 153 2.0E-20
sp|A8XT37|GUF1_CAEBR Translation factor GUF1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG18137 PE=3 SV=1 11 153 2.0E-20
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 6 153 2.0E-20
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 6 153 2.0E-20
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 12 153 2.0E-20
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 10 153 2.0E-20
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 462 1018 3.0E-20
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 10 153 3.0E-20
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|B3EPG7|LEPA_CHLPB Elongation factor 4 OS=Chlorobium phaeobacteroides (strain BS1) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|Q9PQG7|LEPA_UREPA Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=lepA PE=3 SV=1 10 153 3.0E-20
sp|B1AIW2|LEPA_UREP2 Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lepA PE=3 SV=1 10 153 3.0E-20
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 12 153 3.0E-20
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 12 153 3.0E-20
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 12 153 3.0E-20
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q9PKX6|LEPA_CHLMU Elongation factor 4 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|B0BB51|LEPA_CHLTB Elongation factor 4 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|B0B9H2|LEPA_CHLT2 Elongation factor 4 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|Q6KHP1|LEPA_MYCMO Elongation factor 4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lepA PE=3 SV=1 10 153 3.0E-20
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q3KMV7|LEPA_CHLTA Elongation factor 4 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|O84067|LEPA_CHLTR Elongation factor 4 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lepA PE=3 SV=1 13 153 3.0E-20
sp|C5DN84|GUF1_LACTC Translation factor GUF1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GUF1 PE=3 SV=1 3 153 3.0E-20
sp|B5ZBD4|LEPA_UREU1 Elongation factor 4 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=lepA PE=3 SV=1 10 153 3.0E-20
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 6 153 3.0E-20
sp|D0NKK0|GUF1_PHYIT Translation factor GUF1 homolog, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_12454 PE=3 SV=1 6 153 3.0E-20
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|P47384|LEPA_MYCGE Elongation factor 4 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lepA PE=3 SV=1 12 153 3.0E-20
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 14 153 3.0E-20
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 8 153 3.0E-20
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 13 153 3.0E-20
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 6 153 3.0E-20
sp|Q12KH9|LEPA_SHEDO Elongation factor 4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lepA PE=3 SV=1 12 153 3.0E-20
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 6 153 3.0E-20
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 6 153 3.0E-20
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 6 153 3.0E-20
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 6 153 4.0E-20
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 6 153 4.0E-20
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|B1XK44|LEPA_SYNP2 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|A9MGX5|LEPA_SALAR Elongation factor 4 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 10 153 4.0E-20
sp|B7GRY7|LEPA_BIFLS Elongation factor 4 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=lepA PE=3 SV=1 8 153 4.0E-20
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 6 153 4.0E-20
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|P0A1W4|LEPA_SALTY Elongation factor 4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|P0A1W5|LEPA_SALTI Elongation factor 4 OS=Salmonella typhi GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B4TS16|LEPA_SALSV Elongation factor 4 OS=Salmonella schwarzengrund (strain CVM19633) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B4T1G0|LEPA_SALNS Elongation factor 4 OS=Salmonella newport (strain SL254) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B4TE17|LEPA_SALHS Elongation factor 4 OS=Salmonella heidelberg (strain SL476) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B5QTV0|LEPA_SALEP Elongation factor 4 OS=Salmonella enteritidis PT4 (strain P125109) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B5FRC7|LEPA_SALDC Elongation factor 4 OS=Salmonella dublin (strain CT_02021853) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q57LC8|LEPA_SALCH Elongation factor 4 OS=Salmonella choleraesuis (strain SC-B67) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B5F1G3|LEPA_SALA4 Elongation factor 4 OS=Salmonella agona (strain SL483) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|C0PYG5|LEPA_SALPC Elongation factor 4 OS=Salmonella paratyphi C (strain RKS4594) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q8G603|LEPA_BIFLO Elongation factor 4 OS=Bifidobacterium longum (strain NCC 2705) GN=lepA PE=3 SV=1 8 153 4.0E-20
sp|B3DSA9|LEPA_BIFLD Elongation factor 4 OS=Bifidobacterium longum (strain DJO10A) GN=lepA PE=3 SV=1 8 153 4.0E-20
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 14 153 4.0E-20
sp|B5BAS8|LEPA_SALPK Elongation factor 4 OS=Salmonella paratyphi A (strain AKU_12601) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q5PNC0|LEPA_SALPA Elongation factor 4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B7VK81|LEPA_VIBTL Elongation factor 4 OS=Vibrio tasmaniensis (strain LGP32) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B5RD51|LEPA_SALG2 Elongation factor 4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 12 153 4.0E-20
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 14 153 5.0E-20
sp|Q608M4|LEPA_METCA Elongation factor 4 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=lepA PE=3 SV=1 10 153 5.0E-20
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 6 153 5.0E-20
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 6 153 5.0E-20
sp|B1KI55|LEPA_SHEWM Elongation factor 4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 14 153 5.0E-20
sp|A4WDE0|LEPA_ENT38 Elongation factor 4 OS=Enterobacter sp. (strain 638) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|P60792|LEPA_ONYPE Elongation factor 4 OS=Onion yellows phytoplasma (strain OY-M) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|A9KF98|LEPA_COXBN Elongation factor 4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lepA PE=3 SV=1 5 153 5.0E-20
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 3 165 5.0E-20
sp|A1JKK1|LEPA_YERE8 Elongation factor 4 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|Q83BK3|LEPA_COXBU Elongation factor 4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lepA PE=3 SV=2 5 153 5.0E-20
sp|A9N944|LEPA_COXBR Elongation factor 4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lepA PE=3 SV=1 5 153 5.0E-20
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 14 153 5.0E-20
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 8 153 5.0E-20
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 14 153 5.0E-20
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 14 153 5.0E-20
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 12 153 5.0E-20
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 513 989 6.0E-20
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 14 153 6.0E-20
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 13 153 6.0E-20
sp|Q2NS11|LEPA_SODGM Elongation factor 4 OS=Sodalis glossinidius (strain morsitans) GN=lepA PE=3 SV=1 12 153 6.0E-20
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 509 1018 2.0E-19
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 510 720 1.0E-18
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 513 1001 1.0E-18
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 513 989 2.0E-18
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 509 1041 2.0E-18
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 513 989 3.0E-18
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 510 720 4.0E-18
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 513 989 3.0E-17
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 510 720 3.0E-17
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 510 989 2.0E-16
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 510 755 4.0E-16
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 513 720 1.0E-14
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 513 707 1.0E-13
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 513 704 2.0E-13
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 513 707 2.0E-13
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 513 720 7.0E-13
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 844 1041 1.0E-12
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 513 720 1.0E-12
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 513 712 1.0E-12
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 513 712 1.0E-12
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 462 720 1.0E-12
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 844 1041 2.0E-12
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 513 704 2.0E-12
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 513 704 2.0E-12
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 510 731 2.0E-12
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 513 717 4.0E-12
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 553 707 6.0E-12
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 513 704 9.0E-12
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 513 731 1.0E-11
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 460 734 1.0E-11
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 460 734 1.0E-11
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 829 999 1.0E-11
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 509 705 3.0E-11
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 509 735 3.0E-11
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 513 720 3.0E-11
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 460 703 4.0E-11
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 535 704 6.0E-11
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 535 704 6.0E-11
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 854 1001 6.0E-11
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 513 720 9.0E-11
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 844 1041 1.0E-10
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 844 1041 1.0E-10
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 854 1001 1.0E-10
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 513 734 1.0E-10
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 862 1001 3.0E-10
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 862 1001 3.0E-10
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 854 1001 6.0E-10
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 510 703 7.0E-10
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 509 704 9.0E-10
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 509 783 9.0E-10
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 509 704 1.0E-09
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 854 1001 3.0E-09
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 854 1006 2.0E-08
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 618 703 2.0E-08
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 854 1001 2.0E-08
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 854 999 2.0E-08
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 509 704 4.0E-08
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 854 999 5.0E-08
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 854 999 5.0E-08
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 854 999 5.0E-08
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 854 999 6.0E-08
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 854 1001 1.0E-07
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 854 1001 2.0E-07
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 854 1001 3.0E-07
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 854 1001 1.0E-06
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 835 989 1.0E-06
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 835 989 1.0E-06
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 854 999 4.0E-06
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 854 999 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6583 0.5779 0.0137 0.0347 0.103 0.0025 0.0657 0.0517 0.1767 0.0266

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup4872
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|101900
Agaricus bisporus var bisporus H97 AgabiH97|101900 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|50_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101900
MDQKTIESQDPRNIRIITTMGHVDHGKTTLMDALLAANNIISSRMAGKLRYLDSREDEQERGITMESSAVSLRFQ
VMERDDTGGKIPKTYTINMIDTPGHVDFSSEVSTASRLVDGALVLVDVVEGVCTQTIAVLRQAWQDRLRPILVIN
KFDRLITELKLSPVEAYHHLSRLIEQVNAVMGDLFAGERMNDDLRWREERERRLASKKEQLADEADATVNEEDEE
FQEKDDEDIYFAPEKGNVVFASALDGWGFRAGKFSQLYAQKLGIKEANLRRVLWGDYYLDPKTKRVISYKHLRGR
VLKPLFVQFVLENIWAVYDAVILNPNPEKVTKIVSTLSLKIPPRDLKSRDTRQLLSLLCTQWLSLSTCIIQAAID
VVPPPTLAQSLRIPKMLYPDLHEPPSTPNNKLEEDLYNAKAEPASYVTAYVSKMIAVPIKDLPEKKKKSLTAEEM
RAKAREARSVRAKEATLPEEQMGTVSEKLTDAAVASHPSDEAPTSEEAEQTPEENTEIILGFARLYSGVIRRGST
VLALLPKYDRALEPTHPANQKYVLSATVENLYIMMGQDLTAVDFVLPGNIFAIKGLEGKVYRTATLCAPGEKGVE
GDITELQNPKSWLVNLGSVDRSTPPIVRVALEPAHPADMPKLLTGLKLLSQSDPCVETFQQQTGEHVILAAGELH
LERCLKDLRERFAKIEVHASEPIVPFRETAVKAPGKYGTDEDSSPIPTQLLDFILENIVTLKKLLHDRSTQPGKP
AGEEEEETVADKYGEIMRNPSVKPEQFWDALQDKCKEVGGEWEGITDQVWAFGPQRAGGCLLIDARKPKTLTSLK
RRLERAKSNDNNVGTEKAIRDFDNHIEAGFQLATFQGPLAAEPVEGLAYFVEDVDIDQELLEKEIQHNRMAQVTG
SVIAVVRDACRNGLLDWSPRLMLAMYSCDIQASTNVLGKVYGVVAKRRGRIVAEEMKEGTSFFTVSALLPVVESF
GFADDIRKRTSGAASPQLIFSGYEMLDLDPFWVPTTEEELEDLGEKSDRANVAKVYMDGVRGRKGLFVDRKIVEF
AEKQRTLKR*
Coding >AgabiH97|101900
ATGGACCAAAAAACTATTGAAAGTCAAGATCCTCGAAATATTCGTATCATAACGACCATGGGACACGTCGATCAT
GGAAAAACAACACTCATGGACGCGTTACTGGCAGCTAATAACATCATTTCCTCGCGTATGGCAGGCAAATTGAGA
TATCTGGATAGTAGAGAAGACGAACAGGAGAGAGGGATTACAATGGAGAGTAGTGCCGTTTCTCTAAGGTTCCAA
GTAATGGAGCGTGATGATACTGGAGGGAAAATACCAAAGACGTATACCATAAACATGATTGACACACCTGGACAT
GTCGATTTTTCAAGTGAAGTGTCGACTGCTTCAAGACTTGTAGATGGTGCATTAGTTCTTGTGGATGTCGTCGAG
GGTGTCTGTACCCAAACTATCGCTGTACTCAGACAAGCTTGGCAAGATCGCCTTCGTCCAATTCTCGTAATCAAC
AAGTTCGACCGCTTGATCACAGAACTCAAGCTCTCCCCTGTCGAAGCATATCATCATCTTTCACGGTTAATCGAA
CAAGTTAATGCTGTCATGGGTGATTTATTTGCGGGGGAACGTATGAATGATGATCTTCGTTGGAGGGAAGAACGC
GAGAGACGTTTGGCATCGAAGAAAGAACAGCTAGCCGACGAGGCTGATGCTACTGTGAACGAGGAAGACGAAGAG
TTTCAGGAAAAGGATGATGAGGACATATACTTTGCCCCAGAAAAGGGCAATGTCGTTTTTGCTTCCGCATTGGAC
GGCTGGGGTTTCCGTGCAGGCAAATTCTCGCAACTGTATGCTCAGAAGCTGGGAATCAAGGAGGCAAACCTCAGG
AGAGTCCTCTGGGGCGATTATTACCTGGATCCAAAGACAAAGCGGGTCATCAGTTACAAGCACTTACGGGGGAGA
GTATTAAAACCTCTATTTGTGCAATTCGTCTTGGAGAACATATGGGCTGTGTATGATGCCGTAATCCTTAACCCA
AACCCGGAAAAGGTGACCAAAATTGTCAGTACCCTGTCACTGAAAATACCTCCACGCGATCTCAAATCCAGGGAT
ACACGCCAACTTCTCTCACTTCTATGTACCCAATGGCTTTCTCTCTCGACTTGCATAATTCAAGCAGCGATCGAT
GTCGTTCCGCCACCAACGCTCGCTCAATCGTTACGGATACCGAAAATGCTATATCCTGACCTGCATGAGCCACCT
AGTACTCCGAATAACAAGTTGGAAGAGGATCTGTACAACGCAAAGGCAGAACCAGCATCATATGTGACGGCCTAC
GTCAGTAAAATGATTGCAGTTCCGATTAAGGATCTGCCAGAGAAGAAGAAAAAATCTTTGACTGCAGAAGAGATG
AGAGCTAAAGCTAGAGAAGCTAGATCTGTAAGGGCCAAAGAGGCGACTTTGCCTGAAGAACAAATGGGTACTGTG
TCTGAGAAGCTCACTGATGCAGCAGTCGCCTCACATCCTTCGGATGAAGCGCCGACATCGGAAGAAGCGGAGCAG
ACACCAGAAGAAAATACAGAAATCATCCTCGGGTTTGCGCGGTTATACTCTGGTGTCATCAGGAGAGGCAGCACA
GTACTCGCACTGCTGCCAAAATATGACAGGGCGCTAGAGCCAACACATCCCGCCAATCAGAAGTACGTGCTTTCG
GCTACGGTGGAAAATTTGTATATCATGATGGGACAAGACCTCACAGCGGTGGATTTCGTCCTGCCTGGGAATATC
TTTGCGATCAAGGGGTTAGAGGGAAAAGTTTACAGGACTGCAACACTTTGTGCGCCGGGAGAGAAAGGCGTGGAG
GGAGATATCACAGAGTTGCAAAACCCGAAGTCATGGCTAGTCAATTTGGGCTCTGTGGATCGCTCGACGCCGCCC
ATAGTACGTGTCGCTCTCGAACCGGCGCATCCAGCAGATATGCCCAAGCTATTGACCGGGCTGAAGTTACTCAGT
CAGTCGGACCCCTGTGTCGAGACTTTCCAACAACAGACCGGAGAACATGTGATTTTGGCAGCAGGAGAACTACAC
TTAGAGAGGTGTTTGAAAGACCTCCGGGAACGATTTGCCAAGATCGAAGTGCATGCATCCGAACCCATAGTTCCC
TTCAGAGAGACTGCAGTCAAAGCACCAGGAAAATATGGCACCGACGAAGACTCCAGTCCGATACCAACACAACTA
TTGGACTTCATTTTGGAAAACATTGTGACTTTAAAGAAATTGCTACATGATCGAAGTACACAGCCAGGAAAACCT
GCGGGTGAAGAGGAAGAAGAGACTGTTGCCGATAAATATGGCGAAATTATGCGGAATCCGAGCGTCAAACCAGAG
CAATTCTGGGATGCACTTCAGGATAAGTGCAAGGAAGTCGGAGGGGAGTGGGAAGGGATAACTGATCAAGTGTGG
GCATTTGGACCACAGAGAGCCGGCGGCTGTTTGTTGATTGACGCCCGGAAGCCTAAAACTCTAACGTCATTAAAG
AGGCGGCTGGAGCGAGCCAAATCTAATGACAATAACGTCGGAACTGAGAAAGCAATACGTGATTTTGATAACCAT
ATCGAGGCCGGATTCCAGCTAGCGACGTTTCAGGGCCCGTTGGCCGCCGAGCCAGTGGAAGGATTGGCGTATTTT
GTAGAAGACGTCGACATTGATCAAGAGCTCCTCGAAAAAGAAATACAACATAACCGTATGGCCCAAGTCACAGGC
TCAGTTATAGCGGTAGTCAGAGACGCCTGTCGTAACGGACTTCTTGATTGGTCACCAAGGCTGATGTTGGCGATG
TATTCTTGCGATATACAAGCATCAACCAATGTCCTGGGGAAAGTCTATGGAGTCGTCGCCAAGCGGCGTGGTCGA
ATTGTAGCAGAGGAAATGAAAGAGGGAACATCCTTTTTCACAGTTTCTGCGCTTTTGCCGGTCGTGGAAAGTTTC
GGATTTGCTGATGATATCCGGAAGCGCACGTCAGGTGCTGCAAGCCCGCAGCTCATTTTTAGCGGGTATGAAATG
CTTGATCTGGATCCATTTTGGGTTCCCACGACTGAGGAGGAGCTGGAAGATCTGGGCGAGAAGTCCGACCGGGCT
AATGTGGCAAAAGTTTACATGGACGGTGTGCGGGGTAGAAAAGGATTGTTCGTAGACCGGAAGATAGTTGAGTTC
GCGGAGAAGCAGAGGACGTTGAAGCGGTAG
Transcript >AgabiH97|101900
ATGGACCAAAAAACTATTGAAAGTCAAGATCCTCGAAATATTCGTATCATAACGACCATGGGACACGTCGATCAT
GGAAAAACAACACTCATGGACGCGTTACTGGCAGCTAATAACATCATTTCCTCGCGTATGGCAGGCAAATTGAGA
TATCTGGATAGTAGAGAAGACGAACAGGAGAGAGGGATTACAATGGAGAGTAGTGCCGTTTCTCTAAGGTTCCAA
GTAATGGAGCGTGATGATACTGGAGGGAAAATACCAAAGACGTATACCATAAACATGATTGACACACCTGGACAT
GTCGATTTTTCAAGTGAAGTGTCGACTGCTTCAAGACTTGTAGATGGTGCATTAGTTCTTGTGGATGTCGTCGAG
GGTGTCTGTACCCAAACTATCGCTGTACTCAGACAAGCTTGGCAAGATCGCCTTCGTCCAATTCTCGTAATCAAC
AAGTTCGACCGCTTGATCACAGAACTCAAGCTCTCCCCTGTCGAAGCATATCATCATCTTTCACGGTTAATCGAA
CAAGTTAATGCTGTCATGGGTGATTTATTTGCGGGGGAACGTATGAATGATGATCTTCGTTGGAGGGAAGAACGC
GAGAGACGTTTGGCATCGAAGAAAGAACAGCTAGCCGACGAGGCTGATGCTACTGTGAACGAGGAAGACGAAGAG
TTTCAGGAAAAGGATGATGAGGACATATACTTTGCCCCAGAAAAGGGCAATGTCGTTTTTGCTTCCGCATTGGAC
GGCTGGGGTTTCCGTGCAGGCAAATTCTCGCAACTGTATGCTCAGAAGCTGGGAATCAAGGAGGCAAACCTCAGG
AGAGTCCTCTGGGGCGATTATTACCTGGATCCAAAGACAAAGCGGGTCATCAGTTACAAGCACTTACGGGGGAGA
GTATTAAAACCTCTATTTGTGCAATTCGTCTTGGAGAACATATGGGCTGTGTATGATGCCGTAATCCTTAACCCA
AACCCGGAAAAGGTGACCAAAATTGTCAGTACCCTGTCACTGAAAATACCTCCACGCGATCTCAAATCCAGGGAT
ACACGCCAACTTCTCTCACTTCTATGTACCCAATGGCTTTCTCTCTCGACTTGCATAATTCAAGCAGCGATCGAT
GTCGTTCCGCCACCAACGCTCGCTCAATCGTTACGGATACCGAAAATGCTATATCCTGACCTGCATGAGCCACCT
AGTACTCCGAATAACAAGTTGGAAGAGGATCTGTACAACGCAAAGGCAGAACCAGCATCATATGTGACGGCCTAC
GTCAGTAAAATGATTGCAGTTCCGATTAAGGATCTGCCAGAGAAGAAGAAAAAATCTTTGACTGCAGAAGAGATG
AGAGCTAAAGCTAGAGAAGCTAGATCTGTAAGGGCCAAAGAGGCGACTTTGCCTGAAGAACAAATGGGTACTGTG
TCTGAGAAGCTCACTGATGCAGCAGTCGCCTCACATCCTTCGGATGAAGCGCCGACATCGGAAGAAGCGGAGCAG
ACACCAGAAGAAAATACAGAAATCATCCTCGGGTTTGCGCGGTTATACTCTGGTGTCATCAGGAGAGGCAGCACA
GTACTCGCACTGCTGCCAAAATATGACAGGGCGCTAGAGCCAACACATCCCGCCAATCAGAAGTACGTGCTTTCG
GCTACGGTGGAAAATTTGTATATCATGATGGGACAAGACCTCACAGCGGTGGATTTCGTCCTGCCTGGGAATATC
TTTGCGATCAAGGGGTTAGAGGGAAAAGTTTACAGGACTGCAACACTTTGTGCGCCGGGAGAGAAAGGCGTGGAG
GGAGATATCACAGAGTTGCAAAACCCGAAGTCATGGCTAGTCAATTTGGGCTCTGTGGATCGCTCGACGCCGCCC
ATAGTACGTGTCGCTCTCGAACCGGCGCATCCAGCAGATATGCCCAAGCTATTGACCGGGCTGAAGTTACTCAGT
CAGTCGGACCCCTGTGTCGAGACTTTCCAACAACAGACCGGAGAACATGTGATTTTGGCAGCAGGAGAACTACAC
TTAGAGAGGTGTTTGAAAGACCTCCGGGAACGATTTGCCAAGATCGAAGTGCATGCATCCGAACCCATAGTTCCC
TTCAGAGAGACTGCAGTCAAAGCACCAGGAAAATATGGCACCGACGAAGACTCCAGTCCGATACCAACACAACTA
TTGGACTTCATTTTGGAAAACATTGTGACTTTAAAGAAATTGCTACATGATCGAAGTACACAGCCAGGAAAACCT
GCGGGTGAAGAGGAAGAAGAGACTGTTGCCGATAAATATGGCGAAATTATGCGGAATCCGAGCGTCAAACCAGAG
CAATTCTGGGATGCACTTCAGGATAAGTGCAAGGAAGTCGGAGGGGAGTGGGAAGGGATAACTGATCAAGTGTGG
GCATTTGGACCACAGAGAGCCGGCGGCTGTTTGTTGATTGACGCCCGGAAGCCTAAAACTCTAACGTCATTAAAG
AGGCGGCTGGAGCGAGCCAAATCTAATGACAATAACGTCGGAACTGAGAAAGCAATACGTGATTTTGATAACCAT
ATCGAGGCCGGATTCCAGCTAGCGACGTTTCAGGGCCCGTTGGCCGCCGAGCCAGTGGAAGGATTGGCGTATTTT
GTAGAAGACGTCGACATTGATCAAGAGCTCCTCGAAAAAGAAATACAACATAACCGTATGGCCCAAGTCACAGGC
TCAGTTATAGCGGTAGTCAGAGACGCCTGTCGTAACGGACTTCTTGATTGGTCACCAAGGCTGATGTTGGCGATG
TATTCTTGCGATATACAAGCATCAACCAATGTCCTGGGGAAAGTCTATGGAGTCGTCGCCAAGCGGCGTGGTCGA
ATTGTAGCAGAGGAAATGAAAGAGGGAACATCCTTTTTCACAGTTTCTGCGCTTTTGCCGGTCGTGGAAAGTTTC
GGATTTGCTGATGATATCCGGAAGCGCACGTCAGGTGCTGCAAGCCCGCAGCTCATTTTTAGCGGGTATGAAATG
CTTGATCTGGATCCATTTTGGGTTCCCACGACTGAGGAGGAGCTGGAAGATCTGGGCGAGAAGTCCGACCGGGCT
AATGTGGCAAAAGTTTACATGGACGGTGTGCGGGGTAGAAAAGGATTGTTCGTAGACCGGAAGATAGTTGAGTTC
GCGGAGAAGCAGAGGACGTTGAAGCGGTAG
Gene >AgabiH97|101900
ATGGACCAAAAAACTATTGAAAGTCAAGATCCTCGAAATATTCGTATCATAACGACCATGGGACACGTCGATCAT
GGAAAAACAACACTCATGGACGCGTTACTGGCAGCTAATAACATCATTTCCTCGCGTATGGCAGGCAAATTGAGA
TATCTGGATAGTAGAGAAGACGAACAGGAGAGAGGGATTACAATGGAGAGTAGTGCCGTTTCTCTAAGGTTCCAA
GTAATGGAGCGTGATGATACTGGAGGTTCGTCAAGATTAATTTTGCTTGGGGAGATCATATATATATCCAAATGG
CTGATAGGGAAAATACCAAAGACGTATACCATAAACATGATTGACACACCTGGACATGTCGATTTTTCAAGTGAA
GTGTCGACTGCTTCAAGACTTGTAGATGGTGCATTAGTTCTTGTGGATGTCGTCGAGGGTGTCTGTACCCAAGTA
CATCCCTTCCTTACTCATCCACCATCCACACCTAACAATGTTTGCGTAGACTATCGCTGTACTCAGACAAGCTTG
GCAAGATCGCCTTCGTCCAATTCTCGTAATCAACAAGTTCGACCGCTTGATCACAGAACTCAAGCTCTCCCCTGT
CGAAGCATATCATCATCTTTCACGGTTAATCGAACAAGTTAATGCTGTCATGGGTGATTTATTTGCGGGGGAACG
TATGAATGATGATCTTCGTTGGAGGGAAGAACGCGAGAGACGTTTGGCATCGAAGAAAGAACAGCTAGCCGACGA
GGCTGATGCTACTGTGAACGAGGAAGACGAAGAGTTTCAGGAAAAGGATGATGAGGACATATACTTTGCCCCAGA
AAAGGGCAATGTCGTTTTTGCTTCCGCATTGGACGGCTGGGGTTTCCGTGCAGGCAAATTCTCGCAACTGTATGC
TCAGAAGCTGGGAATCAAGGAGGCAAACCTCAGGAGAGTCCTCTGGGGCGATTATTACCTGGATCCAAAGACAAA
GCGGGTCATCAGTTACAAGCACTTACGGGGGAGAGTATTAAAACCTCTATTTGTGCAATTCGTCTTGGAGAACAT
ATGGGCTGTGTATGATGCCGTAATCCTTAACCCGTAAATGCATTCCTTCATTGCTCAGAAATATCACTAAACATC
TCCCAGAAACCCGGAAAAGGTGACCAAAATTGTCAGTACCCTGTCACTGAAAATACCTCCACGCGATCTCAAATC
CAGGGATACACGCCAACTTCTCTCACTTCTATGTACCCAATGGCTTTCTCTCTCGACTTGCATAATTCAAGCAGC
GATCGATGTCGTTCCGCCACCAACGCTCGCTCAATCGTTACGGATACCGAAAATGCTATATCCTGACCTGCATGA
GCCACCTAGTACTCCGAATAACAAGTTGGAAGAGGATCTGTACAACGCAAAGGCAGAACCAGCATCATATGTGAC
GGCCTACGTCAGTAAAATGATTGCAGTTCCGATTAAGGATCTGCCAGAGAAGAAGAAAAAATCTTTGACTGCAGA
AGAGATGAGAGCTAAAGCTAGAGAAGCTAGATCTGTAAGGGCCAAAGAGGCGACTTTGCCTGAAGAACAAATGGG
TACTGTGTCTGAGAAGCTCACTGATGCAGCAGTCGCCTCACATCCTTCGGATGAAGCGCCGACATCGGAAGAAGC
GGAGCAGACACCAGAAGAAAATACAGAAATCATCCTCGGGTTTGCGCGGTTATACTCTGGTGTCATCAGGAGAGG
CAGCACAGTACTCGCACTGCTGCCAAAATATGACAGGGCGCTAGAGCCAACACATCCCGCCAATCAGAAGTACGT
GCTTTCGGCTACGGTGGAAAATTTGTATATCATGATGGGACAAGACCTCACAGCGGTGGATTTCGTCCTGCCTGG
GAATATCTTTGCGATCAAGGGGTTAGAGGGAAAAGTTTACAGGACTGCAACACTTTGTGCGCCGGGAGAGAAAGG
CGTGGAGGGAGATATCACAGAGTTGCAAAACCCGAAGTCATGGCTAGTCAATTTGGGCTCTGTGGATCGCTCGGT
GAGTGAAAGCTCCTGATTGGCCGTTCCTGGTTTCTGACGTGGTTTGTTGTGTAGACGCCGCCCATAGTACGTGTC
GCTCTCGAACCGGCGCATCCAGCAGATATGCCCAAGCTATTGACCGGGCTGAAGTTACTCAGTCAGTCGGACCCC
TGTGTCGAGACTTTCCAACAACAGACCGGAGAACATGTGATTTTGGCAGCAGGAGAACTACACTTAGAGGTGCGC
TGAAATGAATTCATTCCAGGATTAATATCGACGATTATCGTTGGGTAGAGGTGTTTGAAAGACCTCCGGGAACGA
TTTGCCAAGATCGAAGTGCATGCATCCGAACCCATAGTTCCCTTCAGAGAGACTGCAGTCAAAGCACCAGGAAAG
TATGTTTCTTTTGGATATAGTGACCCCTCAATAGACCTCTCATAGATATGGCACCGACGAAGACTCCAGGTGCAA
CACGCGGAACGATCAAGGGAGCAAGTACACAAAATATCGTGTCTTTCACCATCCGCGCGAGTCCGATACCAACAC
AACTATTGGACTTCATTTTGGAAAACATTGTGACTTTAAAGAAATTGCTACATGATCGAAGTACACAGCCAGGAA
AACCTGCGGGTGAAGAGGAAGAAGAGACTGTTGCCGATAAATATGGCGAAATTATGCGGAATCCGAGCGTCAAAC
CAGAGCAATTCTGGGATGCACTTCAGGATAAGTGCAAGGAAGTCGGAGGGGAGTGGGAAGGGATAACTGATCAAG
TGTGGGCATTTGGACCACAGAGAGCCGGCGGCTGTTTGTTGATTGACGCCCGGAAGCCTAAAACTCTAACGTCGT
GAGTGATTCTTCCTTGAATTTACTGTTTTCAGTCTCATTTGATACCAACAATTGATAGATTAAAGAGGCGGCTGG
AGCGAGCCAAATCTAATGACAATAACGTCGGAACTGAGAAAGCAATACGTGATTTTGATAACCATATCGAGGCCG
GATTCCAGCTAGCGACGTTTCAGGGCCCGTTGGCCGCCGAGCCAGTGGAAGGATTGGCGTATTTTGTAGAAGACG
TCGACATTGATCAAGAGCTCCTCGAAAAAGAAATACGTATGTTTCAATTCGACTTGGCTTCACTGTATCTCTAAC
GTACACAGAACATAACCGTATGGCCCAAGTCACAGGCTCAGTTATAGCGGTAGTCAGAGACGCCTGTCGTAACGG
ACTTCTTGATTGGTCACCAAGGCTGATGTTGGCGATGTATTCTTGCGATATACAAGCATCAAGTACGTTTGCAAA
ATCCACGTCTATTTCTAAGTGATGCTGATGAGAAATGTACAGCCAATGTCCTGGGGAAAGTCTATGGAGTCGTCG
CCAAGCGGCGTGGTCGAATTGTAGCAGAGGAAATGAAAGAGGGAACATCCTTTTTCACAGTTTCTGCGCTTTTGC
CGGTCGTGGAAAGTTTCGGATTTGCTGATGGTAAGAAATCATAGCTTTCTTTTGGAGCAACGATTTGAGGTCGTT
GACAGATATCCGGAAGCGCACGTCAGGTGCTGCAAGCCCGCAGCTCATTTTTAGCGGGTAAGTACTTGACCTTTA
TTGACGGAGCAGAATTGACGTTGTCAGGTATGAAATGCTTGATCTGGATCCATTTTGGGTTCCCACGACTGAGGA
GGAGCTGGAAGATCTGGGCGAGAAGTCCGACCGGGCTAATGTGGCAAAAGTTTACATGGACGGTGTGCGGGGTAG
AAAAGGATTGTTCGTAGACCGGAAGATAGTTGAGTTCGCGGAGAAGCAGAGGACGTTGAAGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail