Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101660
Gene name
Locationscaffold_7:1141761..1143270
Strand-
Gene length (bp)1509
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.6E-11 338 381
PF17123 zf-RING_11 RING-like zinc finger 3.4E-11 338 363
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-04 339 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 123 423 3.0E-16
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 125 383 3.0E-16
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 124 426 6.0E-16
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 125 387 1.0E-15
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 112 423 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 123 423 3.0E-16
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 125 383 3.0E-16
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 124 426 6.0E-16
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 125 387 1.0E-15
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 112 423 6.0E-14
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 121 423 4.0E-13
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 121 423 4.0E-13
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 121 385 5.0E-13
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 122 423 2.0E-12
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 121 431 2.0E-12
sp|Q2TA44|RN148_BOVIN RING finger protein 148 OS=Bos taurus GN=RNF148 PE=2 SV=1 112 386 2.0E-12
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 38 423 2.0E-12
sp|G3X9R7|RN148_MOUSE RING finger protein 148 OS=Mus musculus GN=Rnf148 PE=2 SV=1 112 387 3.0E-12
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 45 423 3.0E-12
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 121 423 3.0E-12
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 120 386 4.0E-12
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 119 386 4.0E-12
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 122 386 4.0E-12
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 120 386 1.0E-11
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 120 386 1.0E-11
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 337 423 2.0E-11
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 120 386 2.0E-11
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 38 389 2.0E-11
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 119 386 2.0E-11
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 121 386 5.0E-11
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 121 386 7.0E-11
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 120 386 1.0E-10
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 121 386 1.0E-10
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 121 386 1.0E-10
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 122 386 2.0E-10
sp|Q8WVZ7|RN133_HUMAN E3 ubiquitin-protein ligase RNF133 OS=Homo sapiens GN=RNF133 PE=2 SV=1 119 386 2.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 338 384 2.0E-10
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 122 386 4.0E-10
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 122 386 7.0E-10
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 112 386 7.0E-10
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 339 423 8.0E-10
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 111 386 1.0E-09
sp|Q9LZV8|ATL74_ARATH RING-H2 finger protein ATL74 OS=Arabidopsis thaliana GN=ATL74 PE=2 SV=1 335 386 2.0E-09
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 329 398 3.0E-09
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 339 385 8.0E-09
sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 338 384 8.0E-09
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 338 384 9.0E-09
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 338 384 9.0E-09
sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 338 384 9.0E-09
sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 338 384 1.0E-08
sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 338 384 1.0E-08
sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 338 384 1.0E-08
sp|Q9XF63|ATL3_ARATH RING-H2 finger protein ATL3 OS=Arabidopsis thaliana GN=ATL3 PE=2 SV=1 337 415 1.0E-08
sp|Q8H7N9|ATL31_ORYSJ E3 ubiquitin-protein ligase Os03g0188200 OS=Oryza sativa subsp. japonica GN=Os03g0188200 PE=2 SV=1 337 387 2.0E-08
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 333 384 3.0E-08
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 257 386 4.0E-08
sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 338 385 5.0E-08
sp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=1 338 397 7.0E-08
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 135 386 7.0E-08
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 338 384 7.0E-08
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 338 384 7.0E-08
sp|Q9Y3C5|RNF11_HUMAN RING finger protein 11 OS=Homo sapiens GN=RNF11 PE=1 SV=1 338 384 8.0E-08
sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus GN=RNF11 PE=2 SV=1 338 384 8.0E-08
sp|Q9QYK7|RNF11_MOUSE RING finger protein 11 OS=Mus musculus GN=Rnf11 PE=1 SV=1 338 384 8.0E-08
sp|Q9LJL6|ATL62_ARATH Putative RING-H2 finger protein ATL62 OS=Arabidopsis thaliana GN=ATL62 PE=5 SV=1 333 386 1.0E-07
sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 331 389 2.0E-07
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 334 381 3.0E-07
sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 339 386 3.0E-07
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 338 411 3.0E-07
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 337 423 4.0E-07
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 333 384 4.0E-07
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 339 383 4.0E-07
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 335 385 5.0E-07
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 338 381 5.0E-07
sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 335 384 5.0E-07
sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 337 385 7.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 336 386 7.0E-07
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 294 386 8.0E-07
sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=1 SV=2 333 385 9.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 328 386 9.0E-07
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 337 396 1.0E-06
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 334 386 1.0E-06
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 294 386 1.0E-06
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 294 386 1.0E-06
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 339 384 1.0E-06
sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 302 382 1.0E-06
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 339 384 1.0E-06
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 282 381 1.0E-06
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 339 384 1.0E-06
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 339 384 2.0E-06
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 338 386 2.0E-06
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 339 384 2.0E-06
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 338 392 2.0E-06
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 339 384 2.0E-06
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 339 384 2.0E-06
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 336 386 2.0E-06
sp|Q6NQG7|ATL78_ARATH RING-H2 finger protein ATL78 OS=Arabidopsis thaliana GN=ATL78 PE=2 SV=1 338 388 2.0E-06
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 339 384 2.0E-06
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 334 384 2.0E-06
sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=2 SV=1 331 389 2.0E-06
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 336 386 2.0E-06
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 337 393 2.0E-06
sp|Q9LS99|ATL77_ARATH RING-H2 finger protein ATL77 OS=Arabidopsis thaliana GN=ATL77 PE=2 SV=1 338 389 3.0E-06
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 337 384 3.0E-06
sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 298 387 3.0E-06
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 338 389 4.0E-06
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 334 384 4.0E-06
sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 339 384 5.0E-06
sp|Q5NCP0|RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus GN=Rnf43 PE=2 SV=1 339 386 5.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 337 393 5.0E-06
sp|P0C034|ATL10_ARATH RING-H2 finger protein ATL10 OS=Arabidopsis thaliana GN=ATL10 PE=2 SV=1 338 389 6.0E-06
sp|Q9Y252|RNF6_HUMAN E3 ubiquitin-protein ligase RNF6 OS=Homo sapiens GN=RNF6 PE=1 SV=1 324 392 7.0E-06
sp|Q9D9X6|ZSWM2_MOUSE E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus GN=Zswim2 PE=1 SV=1 338 387 7.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 338 386 9.0E-06
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 334 396 9.0E-06
sp|O49500|MBR2_ARATH E3 ubiquitin-protein ligase MBR2 OS=Arabidopsis thaliana GN=MBR2 PE=1 SV=1 339 381 9.0E-06
sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 337 381 1.0E-05
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 338 384 1.0E-05
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 337 384 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 224 246 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101660
MLLGIVVCNFLPFFFWLASATPTQITHDSLTTTQSDRTWLWSWAWGSESTVSVVDHSPVISYTSRPAAFGAEIAD
PILGYVIPLSSFTAPCGSNDTTDSDSPSNSGCPKLCLTDTRQPTETWIALVQRGGCEFVKKVREVQGFGAKAVVV
GGEDPEVSGYPDTLVNMYSPEDASDINIAATYIKFSDYMQLYTLISSSNTTHSGLQTLSLLITAEYSAWEWYSPI
ITFIVILLLPSVLTFITLLIHRIRAARAAQRERAPEDIVRRLPWRVYTGTGWEKHEGGEPVYDTPRSSDVDLEEG
RSPVEVATSERGSSPTACSDASTSERLMHHPWFEAQLECAICLSEFAKGDRVRVLPCQHIFHLSEVDEWLIHRKK
LCPICKADVTQPCHPSNPHTSPSSAVIHDTLGSRPSHEPQATESTPLLFHGNEEHD*
Coding >AgabiH97|101660
ATGCTTTTGGGCATTGTGGTCTGCAATTTTCTCCCCTTTTTCTTTTGGCTCGCATCCGCCACGCCTACTCAAATC
ACCCATGATTCTCTGACAACAACACAATCCGATAGGACGTGGTTGTGGAGTTGGGCTTGGGGGTCTGAAAGTACT
GTCTCTGTCGTTGACCATTCGCCTGTGATCTCCTACACTTCCAGGCCGGCTGCTTTTGGTGCAGAGATAGCAGAT
CCCATTTTGGGCTACGTTATTCCTCTTTCTTCGTTTACTGCTCCGTGCGGAAGCAATGATACTACCGACTCCGAT
TCCCCATCGAATTCAGGTTGCCCGAAACTATGCCTTACAGACACACGCCAGCCGACAGAAACATGGATTGCACTT
GTTCAACGCGGTGGTTGCGAGTTTGTAAAAAAAGTACGAGAGGTACAGGGCTTTGGTGCGAAAGCTGTCGTTGTA
GGGGGAGAAGACCCAGAGGTTTCGGGTTATCCTGATACCCTCGTTAACATGTACAGCCCAGAGGATGCCTCTGAC
ATCAATATTGCCGCGACCTACATCAAGTTTTCGGACTATATGCAACTCTACACACTCATATCCAGTTCGAATACC
ACACATTCTGGGCTGCAAACACTTAGTCTTCTGATTACCGCAGAATACTCCGCGTGGGAGTGGTACTCGCCAATA
ATCACCTTCATAGTCATCTTGCTTCTTCCATCAGTTTTGACATTTATTACCCTGCTCATACACCGCATACGGGCT
GCTCGTGCAGCACAACGTGAACGTGCCCCCGAAGACATTGTCCGGAGACTTCCATGGCGAGTATATACAGGCACT
GGTTGGGAGAAGCATGAAGGCGGTGAACCCGTTTACGATACCCCTCGCTCCTCAGACGTCGATCTGGAAGAAGGG
AGGTCACCTGTAGAAGTGGCTACATCCGAACGAGGGTCTAGTCCAACGGCTTGTTCTGATGCTTCTACTTCGGAG
CGGCTAATGCACCACCCGTGGTTCGAAGCCCAACTGGAGTGTGCTATCTGTCTATCCGAGTTTGCGAAAGGAGAC
AGAGTCCGTGTGTTACCTTGCCAGCATATATTCCATCTCAGCGAAGTAGACGAGTGGCTTATCCATCGAAAAAAA
CTGTGCCCTATATGCAAAGCCGACGTAACCCAACCGTGCCATCCTTCGAATCCACACACAAGTCCATCATCAGCA
GTTATCCATGATACTCTTGGCAGTCGACCGTCACATGAACCACAAGCGACAGAATCAACACCGCTGTTATTCCAT
GGTAACGAAGAACATGATTGA
Transcript >AgabiH97|101660
ATGCTTTTGGGCATTGTGGTCTGCAATTTTCTCCCCTTTTTCTTTTGGCTCGCATCCGCCACGCCTACTCAAATC
ACCCATGATTCTCTGACAACAACACAATCCGATAGGACGTGGTTGTGGAGTTGGGCTTGGGGGTCTGAAAGTACT
GTCTCTGTCGTTGACCATTCGCCTGTGATCTCCTACACTTCCAGGCCGGCTGCTTTTGGTGCAGAGATAGCAGAT
CCCATTTTGGGCTACGTTATTCCTCTTTCTTCGTTTACTGCTCCGTGCGGAAGCAATGATACTACCGACTCCGAT
TCCCCATCGAATTCAGGTTGCCCGAAACTATGCCTTACAGACACACGCCAGCCGACAGAAACATGGATTGCACTT
GTTCAACGCGGTGGTTGCGAGTTTGTAAAAAAAGTACGAGAGGTACAGGGCTTTGGTGCGAAAGCTGTCGTTGTA
GGGGGAGAAGACCCAGAGGTTTCGGGTTATCCTGATACCCTCGTTAACATGTACAGCCCAGAGGATGCCTCTGAC
ATCAATATTGCCGCGACCTACATCAAGTTTTCGGACTATATGCAACTCTACACACTCATATCCAGTTCGAATACC
ACACATTCTGGGCTGCAAACACTTAGTCTTCTGATTACCGCAGAATACTCCGCGTGGGAGTGGTACTCGCCAATA
ATCACCTTCATAGTCATCTTGCTTCTTCCATCAGTTTTGACATTTATTACCCTGCTCATACACCGCATACGGGCT
GCTCGTGCAGCACAACGTGAACGTGCCCCCGAAGACATTGTCCGGAGACTTCCATGGCGAGTATATACAGGCACT
GGTTGGGAGAAGCATGAAGGCGGTGAACCCGTTTACGATACCCCTCGCTCCTCAGACGTCGATCTGGAAGAAGGG
AGGTCACCTGTAGAAGTGGCTACATCCGAACGAGGGTCTAGTCCAACGGCTTGTTCTGATGCTTCTACTTCGGAG
CGGCTAATGCACCACCCGTGGTTCGAAGCCCAACTGGAGTGTGCTATCTGTCTATCCGAGTTTGCGAAAGGAGAC
AGAGTCCGTGTGTTACCTTGCCAGCATATATTCCATCTCAGCGAAGTAGACGAGTGGCTTATCCATCGAAAAAAA
CTGTGCCCTATATGCAAAGCCGACGTAACCCAACCGTGCCATCCTTCGAATCCACACACAAGTCCATCATCAGCA
GTTATCCATGATACTCTTGGCAGTCGACCGTCACATGAACCACAAGCGACAGAATCAACACCGCTGTTATTCCAT
GGTAACGAAGAACATGATTGA
Gene >AgabiH97|101660
ATGCTTTTGGGCATTGTGGTCTGCAATTTTCTCCCCTTTTTCTTTTGGCTCGCATCCGCCACGCCTACTCAAATC
ACCCATGATTCTCTGACAACAACACAATCCGATAGGACGTGGTTGTGGAGTTGGGCTTGGGGGTCTGAAAGTACT
GTCTCTGTCGTTGACCATTCGCCTGTGATCTCCTACACTTCCAGGCCGGGTGAGCATCGGTATCTCTGGCTGGAT
CTTCCCTCAACTAATGCACACCATAGCTGCTTTTGGTGCAGAGATAGCAGATCCCATTTTGGGCTACGTTATTCC
TCTTTCTTCGTTTACTGCTCCGTGCGGAAGCAATGATACTACCGACTCCGATTCCCCATCGAATTCAGGTTGCCC
GAAACTATGCCTTACAGACACACGCCAGCCGACAGAAACATGGATTGCACTTGTTCAACGCGGTGGTTGCGAGTT
TGTAAAAAAAGTACGAGAGGTACAGGGCTTTGGTGCGAAAGCTGTCGTTGTAGGGGGAGAAGACCCAGAGGTTTC
GGGTTATCCTGATACCCTCGTTAACATGTACAGCCCAGGTTCGTATTTACAGCCCTTTTGGTCGAGTTTCCAGCC
GTCTCACTTGCTCCACAAGAGGATGCCTCTGACATCAATATTGCCGCGACCTACATCAAGTTTTCGGACTATATG
CAACTCTACACACTCATATCCAGTTCGAATACCACACATTCTGGGCTGCAAACACTTAGTCTTCTGATTACCGCA
GAATACTCCGCGTGGGAGTGGTACTCGTAGGTTTCCTCCTTTTCTTACTCCTTCGTCATCGCTCTGAAAATGGTT
TAGGCCAATAATCACCTTCATAGTCATCTTGCTTCTTCCATCAGTTTTGACATTTATTACCCTGCTCATACACCG
CATACGGGCTGCTCGTGCAGCACAACGTGAACGTGCCCCCGAAGACATTGTCCGGAGACTTCCATGGCGAGTATA
TACAGGCACTGGTTGGGAGAAGCATGAAGGCGGTGAACCCGTTTACGATACCCCTCGCTCCTCAGACGTCGATCT
GGAAGAAGGGAGGTCACCTGTAGAAGTGGCTACATCCGAACGAGGGTCTAGTCCAACGGCTTGTTCTGATGCTTC
TACTTCGGAGCGGCTAATGCACCACCCGTGGTTCGAAGCCCAACTGGAGTGTGCTATCTGTCTATCCGAGTTTGC
GAAAGGAGACAGAGTCCGTGTGTTACCTTGCCAGCATATATTCCATCTCAGCGAAGTAGACGAGTGGCTTATCCA
TCGAAAAAAACTGGTAGGTTTTTTACCTGTGGATTTGAGCATACTTCTCACCCACTTCATCGTTAGTGCCCTATA
TGCAAAGCCGACGTAACCCAACCGTGCCATCCTTCGAATCCACACACAAGTCCATCATCAGCAGTTATCCATGAT
ACTCTTGGCAGTCGACCGTCACATGAACCACAAGCGACAGAATCAACACCGCTGTTATTCCATGGTAACGAAGAA
CATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail