Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101430
Gene name
Locationscaffold_7:1100324..1101518
Strand+
Gene length (bp)1194
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01946 Thi4 Thi4 family 2.1E-99 49 289
PF01266 DAO FAD dependent oxidoreductase 2.3E-08 67 121
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.3E-06 70 104
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.5E-06 67 143
PF00890 FAD_binding_2 FAD binding domain 9.0E-05 67 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8NSD1|THI4_COPC7 Thiamine thiazole synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04976 PE=3 SV=2 1 319 0.0E+00
sp|Q4PC85|THI4_USTMA Thiamine thiazole synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11400 PE=3 SV=2 17 318 2.0E-135
sp|Q9UVF8|THI4_UROFA Thiamine thiazole synthase OS=Uromyces fabae GN=THI2 PE=2 SV=1 1 318 3.0E-132
sp|A7EWL8|THI4_SCLS1 Thiamine thiazole synthase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09727 PE=3 SV=1 29 308 3.0E-131
sp|E3JV98|THI4_PUCGT Thiamine thiazole synthase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_01304 PE=3 SV=1 39 318 6.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8NSD1|THI4_COPC7 Thiamine thiazole synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04976 PE=3 SV=2 1 319 0.0E+00
sp|Q4PC85|THI4_USTMA Thiamine thiazole synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11400 PE=3 SV=2 17 318 2.0E-135
sp|Q9UVF8|THI4_UROFA Thiamine thiazole synthase OS=Uromyces fabae GN=THI2 PE=2 SV=1 1 318 3.0E-132
sp|A7EWL8|THI4_SCLS1 Thiamine thiazole synthase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09727 PE=3 SV=1 29 308 3.0E-131
sp|E3JV98|THI4_PUCGT Thiamine thiazole synthase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_01304 PE=3 SV=1 39 318 6.0E-131
sp|Q0UQJ9|THI4_PHANO Thiamine thiazole synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_05965 PE=3 SV=1 38 308 8.0E-131
sp|P40998|THI4_SCHPO Thiamine thiazole synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi2 PE=2 SV=2 35 313 8.0E-131
sp|P23618|THI4_FUSOX Thiamine thiazole synthase OS=Fusarium oxysporum GN=sti35 PE=1 SV=2 7 311 2.0E-130
sp|J9N5G7|THI4_FUSO4 Thiamine thiazole synthase OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sti35 PE=3 SV=1 7 311 2.0E-130
sp|C7Z8P6|THI4_NECH7 Thiamine thiazole synthase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_61890 PE=3 SV=1 31 308 8.0E-130
sp|Q3V7I4|THI4_YARLI Thiamine thiazole synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=THI4 PE=3 SV=1 16 309 5.0E-129
sp|P23617|THI4_FUSSH Thiamine thiazole synthase OS=Fusarium solani subsp. phaseoli GN=sti35 PE=2 SV=1 31 308 6.0E-129
sp|G5EAZ2|THI4_EMENI Thiamine thiazole synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=thiA PE=3 SV=1 37 308 2.0E-125
sp|Q9UUZ9|THI4_ASPOR Thiamine thiazole synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=thiA PE=3 SV=2 38 311 5.0E-125
sp|Q1K6I4|THI4_NEUCR Thiamine thiazole synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06110 PE=1 SV=1 37 308 6.0E-125
sp|Q4WMX7|THI4_ASPFU Thiamine thiazole synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=thiA PE=3 SV=1 10 311 1.0E-124
sp|Q5ANB7|THI4_CANAL Thiamine thiazole synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THI4 PE=3 SV=1 2 308 1.0E-119
sp|C4YNP4|THI4_CANAW Thiamine thiazole synthase OS=Candida albicans (strain WO-1) GN=THI4 PE=3 SV=1 2 308 2.0E-118
sp|C0NSF3|THI4_AJECG Thiamine thiazole synthase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06083 PE=3 SV=2 30 308 5.0E-115
sp|F6H7K5|THI42_VITVI Thiamine thiazole synthase 2, chloroplastic OS=Vitis vinifera GN=THI1-2 PE=3 SV=1 3 305 6.0E-112
sp|A8J9T5|THI4_CHLRE Thiamine thiazole synthase, chloroplastic OS=Chlamydomonas reinhardtii GN=THI1 PE=3 SV=1 34 304 1.0E-111
sp|A9RHW6|THI43_PHYPA Thiamine thiazole synthase 3, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-3 PE=3 SV=1 33 305 7.0E-111
sp|F6H9A9|THI41_VITVI Thiamine thiazole synthase 1, chloroplastic OS=Vitis vinifera GN=THI1-1 PE=3 SV=1 37 305 1.0E-110
sp|A9RHX1|THI41_PHYPA Thiamine thiazole synthase 1, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-1 PE=3 SV=1 33 305 3.0E-110
sp|A9SMC8|THI44_PHYPA Thiamine thiazole synthase 4, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-4 PE=3 SV=1 34 305 3.0E-110
sp|A9SME1|THI42_PHYPA Thiamine thiazole synthase 2, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-2 PE=3 SV=1 34 305 1.0E-109
sp|O23787|THI4_CITSI Thiamine thiazole synthase, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1 34 305 7.0E-106
sp|Q75F65|THI4_ASHGO Thiamine thiazole synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THI4 PE=3 SV=1 12 305 1.0E-103
sp|Q38814|THI4_ARATH Thiamine thiazole synthase, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1 34 318 5.0E-103
sp|P32318|THI4_YEAST Thiamine thiazole synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI4 PE=1 SV=1 15 305 7.0E-103
sp|C5X2M4|THI42_SORBI Thiamine thiazole synthase 2, chloroplastic OS=Sorghum bicolor GN=THI1-2 PE=3 SV=1 34 317 2.0E-102
sp|C5XNN6|THI41_SORBI Thiamine thiazole synthase 1, chloroplastic OS=Sorghum bicolor GN=THI1-1 PE=3 SV=1 34 317 6.0E-101
sp|Q41739|THI42_MAIZE Thiamine thiazole synthase 2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1 34 317 2.0E-100
sp|Q41738|THI41_MAIZE Thiamine thiazole synthase 1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1 34 305 7.0E-100
sp|Q38709|THI4_ALNGL Thiamine thiazole synthase, chloroplastic OS=Alnus glutinosa GN=THI1 PE=2 SV=1 34 305 1.0E-97
sp|Q9Y9Z0|RUBPS_AERPE Putative ribose 1,5-bisphosphate isomerase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2149.1 PE=3 SV=2 40 300 9.0E-33
sp|O59082|RUBPS_PYRHO Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1357 PE=3 SV=2 43 305 3.0E-32
sp|Q97ZY5|RUBPS_SULSO Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0436 PE=3 SV=1 39 314 1.0E-30
sp|C3NGI6|RUBPS_SULIN Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_1140 PE=3 SV=1 39 312 2.0E-30
sp|Q9V0J8|RUBPS_PYRAB Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB07910 PE=3 SV=1 43 304 3.0E-30
sp|Q9WZP4|THI4_THEMA Putative thiazole biosynthetic enzyme OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0787 PE=3 SV=1 48 301 3.0E-30
sp|C3MWW9|RUBPS_SULIM Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1670 PE=3 SV=1 39 312 5.0E-30
sp|Q5JD25|RUBPS_THEKO Putative ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0434 PE=3 SV=1 45 305 5.0E-30
sp|C3N6N6|RUBPS_SULIA Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_1786 PE=3 SV=1 39 312 5.0E-30
sp|C4KIA7|RUBPS_SULIK Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1717 PE=3 SV=1 39 312 5.0E-30
sp|C3MQY1|RUBPS_SULIL Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_1798 PE=3 SV=1 39 312 5.0E-30
sp|C3N749|RUBPS_SULIY Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_1786 PE=3 SV=1 39 312 5.0E-30
sp|Q8U0Q5|RUBPS_PYRFU Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1530 PE=3 SV=1 48 305 4.0E-29
sp|Q4JAF8|RUBPS_SULAC Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0854 PE=3 SV=1 37 305 9.0E-29
sp|Q18KP1|RUBPS_HALWD Putative ribose 1,5-bisphosphate isomerase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=HQ_1276A PE=3 SV=1 39 305 3.0E-28
sp|A8ZVP3|THI4_DESOH Putative thiazole biosynthetic enzyme OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=Dole_2426 PE=3 SV=1 43 302 2.0E-27
sp|A4YIV7|RUBPS_METS5 Putative ribose 1,5-bisphosphate isomerase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2221 PE=3 SV=1 43 305 1.0E-26
sp|Q3V7Z9|RUBPS_HALMA Putative ribose 1,5-bisphosphate isomerase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC1782 PE=3 SV=2 33 304 2.0E-26
sp|Q9HMC7|RUBPS_HALSA Putative ribose 1,5-bisphosphate isomerase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2604G PE=3 SV=1 39 301 3.0E-25
sp|B0R884|RUBPS_HALS3 Putative ribose 1,5-bisphosphate isomerase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=OE_4651F PE=3 SV=1 39 301 3.0E-25
sp|Q975R0|RUBPS_SULTO Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_03610 PE=3 SV=1 37 305 4.0E-24
sp|Q3IMI0|RUBPS_NATPD Putative ribose 1,5-bisphosphate isomerase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=NP_5174A PE=3 SV=1 39 304 9.0E-24
sp|A7HMY3|THI4_FERNB Putative thiazole biosynthetic enzyme OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1422 PE=3 SV=1 43 311 1.0E-23
sp|A3CXS4|RUBPS_METMJ Putative ribose 1,5-bisphosphate isomerase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_2251 PE=3 SV=1 43 301 4.0E-23
sp|A0B880|RUBPS_METTP Putative ribose 1,5-bisphosphate isomerase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=Mthe_1121 PE=3 SV=2 43 304 2.0E-22
sp|O27657|RUBPS_METTH Putative ribose 1,5-bisphosphate isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1620 PE=3 SV=2 43 301 1.0E-21
sp|O29556|RUBPS_ARCFU Putative ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0702 PE=3 SV=1 39 301 2.0E-21
sp|Q58018|RUBPS_METJA Putative ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0601 PE=1 SV=3 45 296 1.0E-20
sp|A4WKY7|RUBPS_PYRAR Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=Pars_1498 PE=3 SV=2 45 301 2.0E-20
sp|Q6LXJ8|RUBPS_METMP Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1352 PE=3 SV=1 45 301 1.0E-19
sp|A1RW13|RUBPS_PYRIL Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=Pisl_1998 PE=3 SV=2 45 300 1.0E-19
sp|Q46AR1|RUBPS_METBF Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A2100 PE=3 SV=1 43 305 9.0E-19
sp|Q12U93|RUBPS_METBU Putative ribose 1,5-bisphosphate isomerase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_2109 PE=3 SV=1 43 301 1.0E-18
sp|A3MWF6|RUBPS_PYRCJ Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_1555 PE=3 SV=1 45 301 1.0E-18
sp|Q8TM19|RUBPS_METAC Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2851 PE=1 SV=1 43 304 4.0E-18
sp|Q8Q0B5|RUBPS_METMA Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0222 PE=3 SV=1 43 304 6.0E-18
sp|B1YDX0|RUBPS_PYRNV Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=Tneu_1052 PE=3 SV=1 45 300 1.0E-17
sp|A6UPZ7|RUBPS_METVS Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0663 PE=3 SV=1 45 301 5.0E-17
sp|Q8ZZM5|RUBPS_PYRAE Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE0175 PE=3 SV=1 45 301 2.0E-16
sp|A6UV59|RUBPS_META3 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0798 PE=3 SV=1 45 296 3.0E-15
sp|A4FWG7|RUBPS_METM5 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0226 PE=3 SV=1 45 301 9.0E-15
sp|A9A9W1|RUBPS_METM6 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=MmarC6_1321 PE=3 SV=1 45 301 1.0E-14
sp|A6VGT9|RUBPS_METM7 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0597 PE=3 SV=1 45 301 1.0E-14
sp|C4XIR5|THI4_DESMR Putative thiazole biosynthetic enzyme OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=DMR_31420 PE=3 SV=1 43 302 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101430
MAPVAVTEQKPSVLQQKYNQSTMTRQKHDVVEDYDGSYKFAPITEAEVSRAMIKRYMTTMYERAISDVVIVGAGS
AGLTCAYTLASLRPDLKITIIEANVAPGGGAWLGGQLMTPMVIRKPADRFVRELGIEYEDEGHFIVIKHAALFTS
TLLSKTLAFPNVVLMNATAVEDLIIHPDAKSQNQRVGGVVTNWTLVALNHDTQSCMDPNTITAPVIVSATGHDGP
MGAFSAKRMVSAGLLKELGNMRGLDMNRAEPAIVNGTREVAPGLVMTGMELSEHDGSNRMGPTFGAMIGSGIKAA
HEAIRIWDSSEIVAGRIVA*
Coding >AgabiH97|101430
ATGGCTCCTGTCGCTGTCACTGAGCAGAAACCTTCTGTTCTCCAACAGAAATACAACCAGTCTACTATGACTCGT
CAAAAACATGACGTTGTCGAAGACTACGATGGCTCATACAAGTTTGCGCCTATCACTGAAGCCGAAGTATCTCGC
GCCATGATTAAGAGGTACATGACCACTATGTACGAACGCGCGATTTCCGACGTCGTCATCGTTGGCGCTGGGAGT
GCTGGATTGACTTGCGCTTACACTTTGGCCAGTCTCCGACCTGACCTCAAGATCACGATCATTGAAGCCAATGTC
GCTCCAGGCGGCGGTGCATGGCTCGGTGGCCAGCTAATGACACCTATGGTTATCCGCAAGCCTGCAGACCGCTTT
GTCCGAGAGCTTGGTATTGAATATGAAGATGAAGGCCACTTTATTGTCATCAAGCATGCTGCTCTCTTCACTTCT
ACCCTGCTGTCCAAGACTCTTGCCTTCCCCAACGTCGTTTTGATGAACGCGACAGCGGTCGAGGACTTGATTATC
CACCCCGACGCCAAATCACAAAACCAGCGTGTTGGCGGTGTCGTCACCAACTGGACCCTCGTGGCCCTTAACCAT
GACACTCAATCCTGCATGGACCCCAACACAATCACTGCACCTGTCATTGTTTCCGCGACGGGACATGATGGACCA
ATGGGTGCCTTCAGTGCCAAGCGCATGGTGAGTGCTGGTCTCCTCAAAGAGCTCGGCAACATGAGGGGCTTGGAT
ATGAATCGTGCGGAACCGGCGATTGTTAATGGTACGCGTGAAGTCGCACCTGGACTCGTCATGACCGGGATGGAG
CTATCCGAACACGATGGTTCGAACCGAATGGGACCCACTTTTGGTGCTATGATTGGTAGCGGAATCAAGGCCGCT
CATGAGGCAATCCGTATCTGGGACTCTTCTGAGATTGTTGCTGGCCGTATTGTCGCTTAG
Transcript >AgabiH97|101430
ATGGCTCCTGTCGCTGTCACTGAGCAGAAACCTTCTGTTCTCCAACAGAAATACAACCAGTCTACTATGACTCGT
CAAAAACATGACGTTGTCGAAGACTACGATGGCTCATACAAGTTTGCGCCTATCACTGAAGCCGAAGTATCTCGC
GCCATGATTAAGAGGTACATGACCACTATGTACGAACGCGCGATTTCCGACGTCGTCATCGTTGGCGCTGGGAGT
GCTGGATTGACTTGCGCTTACACTTTGGCCAGTCTCCGACCTGACCTCAAGATCACGATCATTGAAGCCAATGTC
GCTCCAGGCGGCGGTGCATGGCTCGGTGGCCAGCTAATGACACCTATGGTTATCCGCAAGCCTGCAGACCGCTTT
GTCCGAGAGCTTGGTATTGAATATGAAGATGAAGGCCACTTTATTGTCATCAAGCATGCTGCTCTCTTCACTTCT
ACCCTGCTGTCCAAGACTCTTGCCTTCCCCAACGTCGTTTTGATGAACGCGACAGCGGTCGAGGACTTGATTATC
CACCCCGACGCCAAATCACAAAACCAGCGTGTTGGCGGTGTCGTCACCAACTGGACCCTCGTGGCCCTTAACCAT
GACACTCAATCCTGCATGGACCCCAACACAATCACTGCACCTGTCATTGTTTCCGCGACGGGACATGATGGACCA
ATGGGTGCCTTCAGTGCCAAGCGCATGGTGAGTGCTGGTCTCCTCAAAGAGCTCGGCAACATGAGGGGCTTGGAT
ATGAATCGTGCGGAACCGGCGATTGTTAATGGTACGCGTGAAGTCGCACCTGGACTCGTCATGACCGGGATGGAG
CTATCCGAACACGATGGTTCGAACCGAATGGGACCCACTTTTGGTGCTATGATTGGTAGCGGAATCAAGGCCGCT
CATGAGGCAATCCGTATCTGGGACTCTTCTGAGATTGTTGCTGGCCGTATTGTCGCTTAG
Gene >AgabiH97|101430
ATGGCTCCTGTCGCTGTCACTGAGCAGAAACCTTCTGTTCTCCAACAGAAATACAACCAGTCTACTATGACTCGT
CAAAAACATGACGTTGTCGAAGACTACGATGGCTCATACAAGTTTGCGCCTATCACTGAAGCCGAAGTATCTCGC
GCCATGATTAAGAGGTATGTTCTTTGTTTTTTTGCTATCGAAGTGCCGTCAATGTATAACCCACTGAAACAGGTA
CATGACCACTATGTACGAACGCGCGATTTCCGACGTCGTCATCGTTGGCGCTGGGAGTGCTGGATTGACTTGCGC
TTACACTTTGGCCAGTCTCCGACCTGACGTAAGATTTTTCAACATATTCGTCCAATAGAGTTGGAGTTCTCACCT
CGATCGTTGTATCTTTAGCTCAAGATCACGATCATTGAAGCCAATGTCGCTCCAGGCGGCGGTGCATGGCTCGGT
GGCCAGCTAATGACACCTATGGTATATCTATCTATTTATATAAACCGTTAAGCCATTTTAGATTGCTGATAACCC
TGCTAGGTTATCCGCAAGCCTGCAGACCGCTTTGTCCGAGAGCTTGGTATTGAATATGAAGATGAAGGCCACTTT
ATTGTCATCAAGCATGCTGCTCTCTTCACTTCTACCCTGCTGTCCAAGACTCTTGCCTTCCCCAACGTCGTTTTG
ATGAACGCGACAGCGGTCGAGGACTTGATTATCCACCCCGACGCCAAATCACAAAACCAGCGTGTTGGCGGTGTC
GTCACCAACTGGACCCTCGTGGCCCTTAACCATGACACTCAATCCTGCATGGACCCCAACACAATCACTGCACCT
GTCATTGTTTCCGCGACGGGACATGATGGACCAATGGGTGCCTTCAGTGCCAAGCGCATGGTGAGTGCTGGTCTC
CTCAAAGAGCTCGGCAACATGAGGGGCTTGGATATGAATCGTGCGGAACCGGCGATTGTTAATGGTACGCGTGAA
GTCGCACCTGGACTCGTCATGACCGGTTCGTATCATTTACTTGCACAGAAGTTTAAATATACTGATTTTTCTCCA
GGGATGGAGCTATCCGAACACGATGGTTCGAACCGAATGGGACCCACTTTTGGTGCTATGATTGGTAGCGGAATC
AAGGCCGCTCATGAGGCAATCCGTATCTGGGACTCTTCTGAGATTGTTGCTGGCCGTATTGTCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail