Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|101060
Gene name
Locationscaffold_7:1008993..1009870
Strand-
Gene length (bp)877
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10681 Rot1 Chaperone for protein-folding within the ER, fungal 1.7E-51 31 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6S3W1|ROT1_BOTFB Protein rot1 OS=Botryotinia fuckeliana (strain B05.10) GN=rot1 PE=3 SV=1 31 185 5.0E-34
sp|A7EX99|ROT1_SCLS1 Protein rot1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rot1 PE=3 SV=1 31 185 1.0E-33
sp|Q2USD9|ROT1_ASPOR Protein rot1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rot1 PE=3 SV=2 31 201 1.0E-33
sp|A2QMB8|ROT1_ASPNC Protein rot1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rot1 PE=3 SV=1 31 203 2.0E-33
sp|Q1DNE5|ROT1_COCIM Protein ROT1 OS=Coccidioides immitis (strain RS) GN=ROT1 PE=3 SV=1 31 201 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6S3W1|ROT1_BOTFB Protein rot1 OS=Botryotinia fuckeliana (strain B05.10) GN=rot1 PE=3 SV=1 31 185 5.0E-34
sp|A7EX99|ROT1_SCLS1 Protein rot1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rot1 PE=3 SV=1 31 185 1.0E-33
sp|Q2USD9|ROT1_ASPOR Protein rot1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rot1 PE=3 SV=2 31 201 1.0E-33
sp|A2QMB8|ROT1_ASPNC Protein rot1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rot1 PE=3 SV=1 31 203 2.0E-33
sp|Q1DNE5|ROT1_COCIM Protein ROT1 OS=Coccidioides immitis (strain RS) GN=ROT1 PE=3 SV=1 31 201 2.0E-33
sp|Q5AY94|ROT1_EMENI Protein rot1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rot1 PE=3 SV=1 1 201 5.0E-33
sp|Q755J8|ROT1_ASHGO Protein ROT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ROT1 PE=3 SV=2 8 209 7.0E-33
sp|A1DCU0|ROT1_NEOFI Protein rot1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rot1 PE=3 SV=1 6 201 5.0E-31
sp|Q0CJ00|ROT1_ASPTN Protein rot1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rot1 PE=3 SV=1 31 203 2.0E-30
sp|Q6CFU5|ROT1_YARLI Protein ROT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROT1 PE=3 SV=1 31 204 3.0E-30
sp|A1CDT3|ROT1_ASPCL Protein rot1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rot1 PE=3 SV=1 31 208 3.0E-30
sp|A7TDM0|ROT1_VANPO Protein ROT1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ROT1 PE=3 SV=1 30 206 8.0E-30
sp|O14103|ROT1_SCHPO Protein rot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rot1 PE=3 SV=1 19 185 1.0E-29
sp|Q6BSD5|ROT1_DEBHA Protein ROT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROT1 PE=3 SV=1 24 202 2.0E-28
sp|A6RBY1|ROT1_AJECN Protein ROT1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ROT1 PE=3 SV=1 1 207 2.0E-28
sp|Q03691|ROT1_YEAST Protein ROT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT1 PE=1 SV=1 25 209 7.0E-28
sp|Q6FKL3|ROT1_CANGA Protein ROT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ROT1 PE=3 SV=1 31 185 1.0E-27
sp|A5DN48|ROT1_PICGU Protein ROT1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROT1 PE=3 SV=2 29 202 2.0E-27
sp|A6ZMR2|ROT1_YEAS7 Protein ROT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ROT1 PE=3 SV=1 25 185 1.0E-26
sp|Q6CL16|ROT1_KLULA Protein ROT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ROT1 PE=3 SV=1 31 205 4.0E-26
sp|Q5ABP8|ROT1_CANAL Protein ROT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ROT1 PE=3 SV=1 3 199 7.0E-25
sp|A5DVH1|ROT1_LODEL Protein ROT1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ROT1 PE=3 SV=1 29 199 1.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005783 endoplasmic reticulum Yes
GO:0006458 'de novo' protein folding Yes
GO:0006457 protein folding No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|101060
MLFTPVLGLVLASFTPVVYSQLPLEQAQQTLIGTWSSGSKHVLTGPGFANPANQSFNYPPTTGISYSFTDTFYEL
SRYRFNSNGSDPTCITGVIGWSHGKYQLNTNGSMTLFPFPDGYQQIQDPCAAVSNFIEDYRITEELYVQWAIFLD
PTFGFKLHLNQFDGAPLAPMFQVSPQPNMLPTQPLRNVSDPNADSESNVQRRGLSKSAL*
Coding >AgabiH97|101060
ATGCTTTTCACCCCTGTTCTTGGCCTCGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGGCTTCGCCAAC
CCTGCCAACCAGTCGTTCAACTATCCTCCAACTACTGGGATTTCGTACTCTTTCACCGATACGTTTTATGAACTT
TCACGCTATCGTTTCAACAGCAATGGTTCCGATCCCACCTGCATTACTGGTGTCATTGGCTGGTCTCATGGCAAA
TACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACAAATTCAAGACCCATGT
GCAGCTGTCTCCAACTTCATCGAAGATTATAGGATCACAGAAGAGCTGTATGTGCAGTGGGCAATTTTCCTGGAC
CCAACCTTTGGCTTCAAACTCCATTTGAACCAGTTTGATGGTGCCCCGTTGGCTCCGATGTTCCAAGTTTCACCG
CAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTCTGAGTCGAATGTACAA
CGAAGAGGATTGTCGAAATCAGCACTATGA
Transcript >AgabiH97|101060
ATGCTTTTCACCCCTGTTCTTGGCCTCGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGGCTTCGCCAAC
CCTGCCAACCAGTCGTTCAACTATCCTCCAACTACTGGGATTTCGTACTCTTTCACCGATACGTTTTATGAACTT
TCACGCTATCGTTTCAACAGCAATGGTTCCGATCCCACCTGCATTACTGGTGTCATTGGCTGGTCTCATGGCAAA
TACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACAAATTCAAGACCCATGT
GCAGCTGTCTCCAACTTCATCGAAGATTATAGGATCACAGAAGAGCTGTATGTGCAGTGGGCAATTTTCCTGGAC
CCAACCTTTGGCTTCAAACTCCATTTGAACCAGTTTGATGGTGCCCCGTTGGCTCCGATGTTCCAAGTTTCACCG
CAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTCTGAGTCGAATGTACAA
CGAAGAGGATTGTCGAAATCAGCACTATGA
Gene >AgabiH97|101060
ATGCTTTTCACCCCTGTTCTTGGCCTCGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGTAAGTCCTTGG
ATCCTTCAGCAGCGGTCTGAGTTTACCCCTTTACTTGCAGGGCTTCGCCAACCCTGCCAACCAGTCGTTCAACTA
TCCTCCAACTACTGGGATTTCGTACTCTTTGTGCGTAGCAAAAAACCTGATCATACTAAATACCCAGTCGCTGAA
TCTTTGCTTATGCAGCACCGATACGTTTTATGAACTTTCACGCTATCGTTTCAACAGCAATGGTGCGTGGCACTG
CCTTATCTCTCCCTCAGCTACTCATATTCGACGGTATCCAGGTTCCGATCCCACCTGCATTACTGGTGTCATTGG
CTGGTCTCATGGCAAATACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACA
AATTCAAGACCCATGTGCAGCTGTCTCCAACTTCATCGAAGATTATAGGATCACAGAAGAGCTGTATGTGCAGTG
GGCAATTTTCCTGGACCCAACCTTTGGCTTCAAACTCCATTTGAACCAGTTTGATGGTGCCCCGTTGGCTCCGAT
GTTCCAAGTTTCACCGCAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTC
TGAGTCGAATGTACAACGAAGAGGATTGTCGAAATCAGGTGCGCTCAGCAGTCGGCGGGTAGATAACGTGGTGAC
GACGGGAGTTTCGGGATTGATTGTTGCCGCATTTGCTTCGCTAGCACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail