© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|100930 |
| Gene name | |
| Location | scaffold_7:986103..986675 |
| Strand | - |
| Gene length (bp) | 572 |
| Transcript length (bp) | 408 |
| Coding sequence length (bp) | 408 |
| Protein length (aa) | 136 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF12597 | Cox20 | Cytochrome c oxidase assembly protein COX20 | 1.2E-20 | 38 | 116 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005743 | mitochondrial inner membrane | Yes |
| GO:0033617 | mitochondrial cytochrome c oxidase assembly | Yes |
| GO:0008150 | biological_process | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0031966 | mitochondrial membrane | No |
| GO:0017004 | cytochrome complex assembly | No |
| GO:0019866 | organelle inner membrane | No |
| GO:0043933 | protein-containing complex organization | No |
| GO:0009987 | cellular process | No |
| GO:0031090 | organelle membrane | No |
| GO:0033108 | mitochondrial respiratory chain complex assembly | No |
| GO:0016020 | membrane | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0016043 | cellular component organization | No |
| GO:0022607 | cellular component assembly | No |
| GO:0005575 | cellular_component | No |
| GO:0008535 | respiratory chain complex IV assembly | No |
| GO:0065003 | protein-containing complex assembly | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 69 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 71.84 | 36.16 | 107.52 |
| Initials | Initials knots | 58.88 | 29.16 | 88.60 |
| Pileal_Stipeal_center | Stage I stipe center | 79.66 | 40.35 | 118.96 |
| Pileal_Stipeal_shell | Stage I stipe shell | 116.57 | 62.93 | 170.21 |
| DIF_stipe_center | Stage II stipe center | 104.36 | 55.94 | 152.78 |
| DIF_stipe_shell | Stage II stipe shell | 85.40 | 43.71 | 127.09 |
| DIF_stipe_skin | Stage II stipe skin | 82.53 | 42.39 | 122.67 |
| DIF_cap_skin | Stage II cap skin | 118.00 | 63.87 | 172.14 |
| DIF_cap_tissue | Stage II cap tissue | 121.08 | 65.84 | 176.32 |
| DIF_gill_tissue | Stage II gill tissue | 131.44 | 72.70 | 190.17 |
| YFB_stipe_center | Young fruiting body stipe center | 102.46 | 54.92 | 150.00 |
| YFB_stipe_shell | Young fruiting body stipe shell | 90.67 | 47.83 | 133.51 |
| YFB_stipe_skin | Young fruiting body stipe skin | 84.54 | 44.08 | 124.99 |
| YFB_cap_skin | Young fruiting body cap skin | 102.88 | 54.64 | 151.11 |
| YFB_cap_tissue | Young fruiting body cap tissue | 123.12 | 66.94 | 179.31 |
| YFB_gill_tissue | Young fruiting body gill tissue | 99.31 | 52.34 | 146.29 |
| YFB_veil | Young fruiting body veil | 114.56 | 62.12 | 167.00 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.053358 | no |
| Casing | YFB_stipe_center | 0.347654 | no |
| Casing | YFB_stipe_shell | 0.593603 | no |
| Casing | YFB_stipe_skin | 0.744378 | no |
| Casing | YFB_cap_skin | 0.352947 | no |
| Casing | YFB_cap_tissue | 0.103148 | no |
| Casing | YFB_gill_tissue | 0.417847 | no |
| Casing | YFB_veil | 0.168023 | no |
| Casing | Initials | 0.684007 | no |
| Casing | Pileal_Stipeal_center | 0.855567 | no |
| Casing | Pileal_Stipeal_shell | 0.155703 | no |
| Casing | DIF_stipe_center | 0.313705 | no |
| Casing | DIF_stipe_shell | 0.729978 | no |
| Casing | DIF_stipe_skin | 0.797581 | no |
| Casing | DIF_cap_skin | 0.140843 | no |
| Casing | DIF_cap_tissue | 0.111482 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.546138 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.299932 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.189390 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.564525 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.912036 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.486509 | no |
| DIF_gill_tissue | YFB_veil | 0.780715 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.815588 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.671942 | no |
| YFB_stipe_center | YFB_cap_skin | 0.993555 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.686696 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.961401 | no |
| YFB_stipe_center | YFB_veil | 0.834384 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.906022 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.814616 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.434632 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.872760 | no |
| YFB_stipe_shell | YFB_veil | 0.578131 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.675228 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.295038 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.745775 | no |
| YFB_stipe_skin | YFB_veil | 0.426213 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.707811 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.956845 | no |
| YFB_cap_skin | YFB_veil | 0.846100 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.634330 | no |
| YFB_cap_tissue | YFB_veil | 0.904203 | no |
| YFB_gill_tissue | YFB_veil | 0.778398 | no |
| Initials | DIF_gill_tissue | 0.007092 | yes |
| Initials | YFB_stipe_center | 0.091161 | no |
| Initials | YFB_stipe_shell | 0.234297 | no |
| Initials | YFB_stipe_skin | 0.349565 | no |
| Initials | YFB_cap_skin | 0.101705 | no |
| Initials | YFB_cap_tissue | 0.020790 | yes |
| Initials | YFB_gill_tissue | 0.127489 | no |
| Initials | YFB_veil | 0.035993 | yes |
| Initials | Pileal_Stipeal_center | 0.473074 | no |
| Initials | Pileal_Stipeal_shell | 0.028675 | yes |
| Initials | DIF_stipe_center | 0.080532 | no |
| Initials | DIF_stipe_shell | 0.350412 | no |
| Initials | DIF_stipe_skin | 0.417263 | no |
| Initials | DIF_cap_skin | 0.029648 | yes |
| Initials | DIF_cap_tissue | 0.022111 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.123958 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.556819 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.808997 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.925081 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.555787 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.210782 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.630233 | no |
| Pileal_Stipeal_center | YFB_veil | 0.322431 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.300200 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.516188 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.912946 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.958965 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.278683 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.235697 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.816519 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.802455 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.548092 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.401250 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.817309 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.927567 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.748843 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.978233 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.837570 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.443449 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.375110 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.984165 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.950386 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.574299 | no |
| DIF_stipe_center | YFB_stipe_center | 0.976188 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.776677 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.633639 | no |
| DIF_stipe_center | YFB_cap_skin | 0.981414 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.726472 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.936643 | no |
| DIF_stipe_center | YFB_veil | 0.866027 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.664948 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.593603 | no |
| DIF_stipe_center | DIF_cap_skin | 0.812232 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.760831 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.223716 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.708192 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.925408 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.987356 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.708650 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.333265 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.774370 | no |
| DIF_stipe_shell | YFB_veil | 0.470241 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.962135 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.415354 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.368799 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.171000 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.633307 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.871569 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.970787 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.636181 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.273347 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.705361 | no |
| DIF_stipe_skin | YFB_veil | 0.403148 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.350157 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.306617 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.837628 | no |
| DIF_cap_skin | YFB_stipe_center | 0.777604 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.525018 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.375595 | no |
| DIF_cap_skin | YFB_cap_skin | 0.793570 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.945713 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.722094 | no |
| DIF_cap_skin | YFB_veil | 0.962202 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.966980 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.885552 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.727626 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.468413 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.328183 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.745981 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.978871 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.667703 | no |
| DIF_cap_tissue | YFB_veil | 0.927433 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|100930 MASSDPQRNPTTEEEQNAINLPSSLPQPTGNLAYDSVQSALNVTSIPCSRESLLAGIAAGVGIGVVRGLTLPPIK AGNWAVATFALTSLISWQICQNKIKREREQVATVLEQAPRRRAVASGNDNDSSSSATTNS* |
| Coding | >AgabiH97|100930 ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGT GAAAGTCTACTTGCTGGGATTGCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCCACCTATAAAG GCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGATATCATGGCAGATATGTCAGAATAAAATCAAG CGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTAGTGGAAATGACAAT GATTCATCATCATCCGCCACTACAAATTCTTGA |
| Transcript | >AgabiH97|100930 ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGT GAAAGTCTACTTGCTGGGATTGCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCCACCTATAAAG GCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGATATCATGGCAGATATGTCAGAATAAAATCAAG CGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTAGTGGAAATGACAAT GATTCATCATCATCCGCCACTACAAATTCTTGA |
| Gene | >AgabiH97|100930 ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAGTGAGTTTCAAATTCGTTATTCTATATGCTTGACCA TAGCTTTTGATCGTTCAGAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGTGAAAGTCTACTTGCTGGGATT GCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCGTATGTCCCTCAAAGTTTCGAAAAAACCATTT TCCTTACAAACATGTATCAGCACCTATAAAGGCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGAT ATCATGGTAAAACACTTCTCTTTCATTCAATCTATATACTTCGAAACTAATCACTATAAAACAGGCAGATATGTC AGAATAAAATCAAGCGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTA GTGGAAATGACAATGATTCATCATCATCCGCCACTACAAATTCTTGA |