Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|100930
Gene name
Locationscaffold_7:986103..986675
Strand-
Gene length (bp)572
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12597 Cox20 Cytochrome c oxidase assembly protein COX20 1.2E-20 38 116

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0031966 mitochondrial membrane No
GO:0017004 cytochrome complex assembly No
GO:0019866 organelle inner membrane No
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0031090 organelle membrane No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0005575 cellular_component No
GO:0008535 respiratory chain complex IV assembly No
GO:0065003 protein-containing complex assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|100930
MASSDPQRNPTTEEEQNAINLPSSLPQPTGNLAYDSVQSALNVTSIPCSRESLLAGIAAGVGIGVVRGLTLPPIK
AGNWAVATFALTSLISWQICQNKIKREREQVATVLEQAPRRRAVASGNDNDSSSSATTNS*
Coding >AgabiH97|100930
ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA
CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGT
GAAAGTCTACTTGCTGGGATTGCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCCACCTATAAAG
GCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGATATCATGGCAGATATGTCAGAATAAAATCAAG
CGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTAGTGGAAATGACAAT
GATTCATCATCATCCGCCACTACAAATTCTTGA
Transcript >AgabiH97|100930
ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA
CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGT
GAAAGTCTACTTGCTGGGATTGCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCCACCTATAAAG
GCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGATATCATGGCAGATATGTCAGAATAAAATCAAG
CGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTAGTGGAAATGACAAT
GATTCATCATCATCCGCCACTACAAATTCTTGA
Gene >AgabiH97|100930
ATGGCGTCGTCCGATCCACAACGAAACCCAACAACTGAAGAAGAGCAAAATGCAATTAATCTTCCATCTAGTCTA
CCCCAACCAACCGGAAATCTCGCTTACGACTCTGTTCAAGTGAGTTTCAAATTCGTTATTCTATATGCTTGACCA
TAGCTTTTGATCGTTCAGAGCGCGTTAAATGTTACTTCTATCCCATGTTCACGTGAAAGTCTACTTGCTGGGATT
GCTGCTGGAGTGGGTATAGGTGTCGTTCGTGGTCTAACGCTTCGTATGTCCCTCAAAGTTTCGAAAAAACCATTT
TCCTTACAAACATGTATCAGCACCTATAAAGGCTGGAAATTGGGCTGTGGCGACATTTGCACTTACTTCATTGAT
ATCATGGTAAAACACTTCTCTTTCATTCAATCTATATACTTCGAAACTAATCACTATAAAACAGGCAGATATGTC
AGAATAAAATCAAGCGAGAGCGTGAACAAGTTGCTACTGTATTAGAACAAGCCCCTCGACGACGAGCAGTTGCTA
GTGGAAATGACAATGATTCATCATCATCCGCCACTACAAATTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail