Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|100890
Gene name
Locationscaffold_7:973243..975690
Strand+
Gene length (bp)2447
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17292 POB3_N POB3-like N-terminal PH domain 1.4E-30 4 96
PF03531 SSrecog Structure-specific recognition protein (SSRP1) 6.1E-26 103 172
PF08512 Rtt106 Histone chaperone Rttp106-like 4.2E-21 356 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P647|POB3_USTMA FACT complex subunit POB3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=POB3 PE=3 SV=1 2 524 3.0E-147
sp|P0CR74|POB3_CRYNJ FACT complex subunit POB3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=POB3 PE=3 SV=1 1 491 1.0E-146
sp|P0CR75|POB3_CRYNB FACT complex subunit POB3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=POB3 PE=3 SV=1 1 491 1.0E-146
sp|O94529|POB3_SCHPO FACT complex subunit pob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob3 PE=3 SV=1 3 446 8.0E-128
sp|Q4WGK6|POB3_ASPFU FACT complex subunit pob3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pob3 PE=3 SV=2 6 556 4.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P647|POB3_USTMA FACT complex subunit POB3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=POB3 PE=3 SV=1 2 524 3.0E-147
sp|P0CR74|POB3_CRYNJ FACT complex subunit POB3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=POB3 PE=3 SV=1 1 491 1.0E-146
sp|P0CR75|POB3_CRYNB FACT complex subunit POB3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=POB3 PE=3 SV=1 1 491 1.0E-146
sp|O94529|POB3_SCHPO FACT complex subunit pob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob3 PE=3 SV=1 3 446 8.0E-128
sp|Q4WGK6|POB3_ASPFU FACT complex subunit pob3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pob3 PE=3 SV=2 6 556 4.0E-126
sp|Q5AYE3|POB3_EMENI FACT complex subunit pob3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pob3 PE=3 SV=2 6 556 3.0E-124
sp|Q7RWW0|POB3_NEUCR FACT complex subunit ctc-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ctc-1 PE=3 SV=1 2 466 7.0E-121
sp|Q4IJU0|POB3_GIBZE FACT complex subunit POB3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=POB3 PE=3 SV=1 2 471 1.0E-115
sp|Q6BS60|POB3_DEBHA FACT complex subunit POB3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=POB3 PE=3 SV=1 1 529 2.0E-115
sp|Q2USL9|POB3_ASPOR FACT complex subunit pob3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pob3 PE=3 SV=1 6 527 4.0E-114
sp|Q5ALL8|POB3_CANAL FACT complex subunit POB3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POB3 PE=3 SV=1 1 449 1.0E-113
sp|Q6C7V4|POB3_YARLI FACT complex subunit POB3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POB3 PE=3 SV=1 1 526 9.0E-113
sp|Q756X6|POB3_ASHGO FACT complex subunit POB3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=POB3 PE=3 SV=1 3 553 3.0E-106
sp|Q04636|POB3_YEAST FACT complex subunit POB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POB3 PE=1 SV=1 3 536 5.0E-101
sp|Q6CWD7|POB3_KLULA FACT complex subunit POB3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=POB3 PE=3 SV=1 3 551 1.0E-99
sp|Q6FKI2|POB3_CANGA FACT complex subunit POB3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=POB3 PE=3 SV=1 3 512 3.0E-99
sp|Q04678|SSRP1_CHICK FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2 3 508 3.0E-89
sp|Q08943|SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2 3 509 1.0E-88
sp|Q04931|SSRP1_RAT FACT complex subunit SSRP1 OS=Rattus norvegicus GN=Ssrp1 PE=1 SV=2 3 509 1.0E-88
sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1 3 509 2.0E-87
sp|O04235|SSRP1_VICFA FACT complex subunit SSRP1 OS=Vicia faba GN=SSRP1 PE=2 SV=1 8 536 2.0E-84
sp|Q4H2R2|SSRP1_CIOIN FACT complex subunit SSRP1 OS=Ciona intestinalis GN=SSRP1 PE=2 SV=1 18 448 2.0E-82
sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 3 630 3.0E-82
sp|Q05344|SSRP1_DROME FACT complex subunit Ssrp1 OS=Drosophila melanogaster GN=Ssrp PE=1 SV=2 18 472 8.0E-79
sp|Q293F6|SSRP1_DROPS FACT complex subunit Ssrp1 OS=Drosophila pseudoobscura pseudoobscura GN=Ssrp PE=3 SV=2 18 472 1.0E-77
sp|Q39601|SSRP1_CATRO FACT complex subunit SSRP1 OS=Catharanthus roseus GN=SSRP1 PE=2 SV=1 8 528 2.0E-77
sp|Q9LGR0|SSP1A_ORYSJ FACT complex subunit SSRP1-A OS=Oryza sativa subsp. japonica GN=SSRP1-A PE=2 SV=1 8 446 5.0E-76
sp|Q54G78|SSRP1_DICDI FACT complex subunit SSRP1 OS=Dictyostelium discoideum GN=ssrp1 PE=3 SV=1 3 458 3.0E-74
sp|Q05153|SSRP1_ARATH FACT complex subunit SSRP1 OS=Arabidopsis thaliana GN=SSRP1 PE=1 SV=2 18 446 6.0E-74
sp|Q65WY8|SSP1B_ORYSJ FACT complex subunit SSRP1-B OS=Oryza sativa subsp. japonica GN=SSRP1-B PE=2 SV=1 18 536 5.0E-72
sp|Q9LEF5|SSRP1_MAIZE FACT complex subunit SSRP1 OS=Zea mays GN=SSRP1 PE=1 SV=1 18 618 4.0E-68
sp|O01683|SSP1B_CAEEL FACT complex subunit ssrp1-B OS=Caenorhabditis elegans GN=hmg-3 PE=3 SV=1 17 537 8.0E-67
sp|P41848|SSP1A_CAEEL FACT complex subunit SSRP1-A OS=Caenorhabditis elegans GN=hmg-4 PE=3 SV=1 1 448 6.0E-65
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|100890
MATTQFDHIFHSLAPDVGKFRVAPSGMAWKGSDSEAVVAMASTDIKWAQWLRVARNFQLRVGMRDHRKEKFDGFM
REDHDKLASLLKNHFGITLETREVSFKGWNWGVTDFQGSDLAFMVQDKVAFELPLRHVANSNIAGRTEVSLEFTP
LGKGSKALGDEMMEIRFHVPGTQKSKATGSDAGSQKSDDEEDDISAAQVFHDTIKEKAELGQVSGDLILSFEEIL
VLTPRGRYDMDMSHEYLRLRGKTYDYKIMYNSISKLFLLPKDDQRVLFILGLSIPIRQGQTRYQYLVMQFSREEE
ITAELNMTEEEVAKYDRLKKNYEDPTFEVVSSVFRALAKKKIVGAGSFQSRDGHPGIKANLKAIQGDLFLLEKYI
FFVSKSPLLVEIADIHQVVFSRVGASMGAAAARTFDLKIVTKSGAEHTFTSINKEEHESVDAYLKDKKIKIKTET
VPDVDMILAAGVGDDDDEDDEDMRSIDSDDDGGRTRNKPSKKTTGSGDGDDDSEDDEDFEASDSDAGSPSDSDSD
DSGAATASDASGDLAITAENSNKKAKGAKGKGKATDGTKKTGKKKSAAAEESDADDDEGGKKKAAPKPKPKPKPK
VKSGEDENGMEVDDDDKPKPKPKPKPKPKVKDTAAMDVDGDDGGDKPKPKPKPKPRPRTKESPNGGDGDEVEPPK
KKLKTSSSSRD*
Coding >AgabiH97|100890
ATGGCCACGACTCAGTTCGACCACATCTTCCACAGCCTCGCCCCAGATGTCGGCAAATTTCGTGTCGCACCCAGC
GGCATGGCCTGGAAAGGCTCAGACTCAGAGGCCGTCGTAGCAATGGCTTCTACAGATATCAAGTGGGCTCAATGG
CTTCGGGTCGCCAGGAACTTCCAGCTGCGCGTCGGCATGCGTGATCACCGCAAGGAAAAATTTGACGGCTTCATG
CGAGAGGACCACGATAAACTCGCCTCCTTGCTCAAAAACCATTTTGGAATCACACTAGAAACGCGAGAGGTTTCT
TTTAAAGGGTGGAATTGGGGCGTAACAGACTTCCAAGGCTCGGACCTAGCTTTCATGGTCCAGGACAAAGTAGCA
TTCGAGTTACCTCTACGACACGTCGCGAACTCTAATATTGCCGGTCGAACAGAAGTCTCGCTCGAATTCACCCCT
CTAGGCAAAGGCAGTAAAGCTCTTGGCGATGAGATGATGGAAATTCGCTTCCACGTGCCTGGAACACAGAAATCC
AAGGCCACAGGTTCGGACGCAGGATCCCAAAAGTCTGATGATGAAGAGGACGACATTAGTGCCGCTCAAGTCTTC
CACGATACCATCAAGGAGAAGGCTGAGCTTGGCCAAGTCTCTGGAGATCTCATCCTCAGCTTTGAAGAAATTTTG
GTCCTGACACCTCGTGGTCGTTATGATATGGATATGTCACATGAATATTTGCGTCTGCGCGGAAAAACCTACGAC
TATAAGATCATGTACAATTCCATCTCAAAGCTCTTCTTGCTCCCCAAGGATGACCAACGCGTGCTCTTTATTCTT
GGTCTTAGCATACCCATCAGACAAGGTCAAACCCGCTATCAATACCTTGTGATGCAATTCAGCCGTGAGGAGGAG
ATCACTGCCGAACTTAACATGACTGAGGAGGAAGTTGCCAAATACGATCGCCTAAAGAAAAATTACGAAGACCCT
ACCTTTGAAGTTGTGTCCAGCGTCTTCCGTGCACTGGCGAAGAAAAAGATCGTCGGGGCTGGTAGTTTCCAAAGT
CGAGACGGTCACCCTGGTATCAAAGCCAATCTAAAAGCCATTCAAGGCGATTTATTCCTACTGGAAAAATACATC
TTTTTCGTCTCTAAATCACCCCTCCTAGTCGAAATAGCCGACATTCATCAAGTCGTGTTTTCTCGTGTTGGTGCA
AGCATGGGCGCTGCCGCAGCGCGTACTTTTGATCTAAAAATCGTAACAAAATCTGGAGCAGAGCATACGTTTACG
TCTATCAATAAAGAAGAACATGAGAGTGTTGACGCATATTTGAAGGATAAGAAGATTAAAATAAAGACGGAGACT
GTGCCTGATGTGGATATGATACTAGCTGCGGGTGTTGGGGATGATGATGATGAGGATGATGAAGATATGAGGAGT
ATCGATTCGGACGATGATGGTGGGCGTACTAGAAACAAACCCTCGAAGAAAACTACTGGTAGTGGTGATGGTGAC
GATGATAGCGAGGATGATGAGGACTTTGAAGCATCTGATTCTGACGCGGGATCACCAAGTGATAGTGATTCAGAT
GATTCCGGAGCAGCAACAGCATCAGATGCTAGCGGTGACCTAGCCATCACAGCAGAAAACAGTAACAAAAAAGCT
AAAGGTGCCAAGGGTAAAGGCAAAGCCACTGACGGTACAAAAAAAACCGGCAAGAAGAAGTCGGCGGCAGCAGAG
GAAAGTGATGCGGACGATGATGAAGGAGGCAAGAAGAAAGCAGCGCCTAAACCAAAACCGAAACCAAAACCCAAA
GTAAAATCCGGGGAGGATGAGAATGGAATGGAGGTGGATGACGATGACAAGCCTAAACCGAAGCCTAAACCGAAA
CCAAAACCGAAAGTGAAAGATACCGCTGCTATGGACGTTGATGGTGATGACGGTGGCGACAAGCCCAAGCCCAAG
CCGAAACCGAAACCGAGACCGAGGACAAAGGAGAGTCCCAACGGTGGTGATGGCGATGAAGTCGAGCCGCCTAAA
AAGAAACTCAAAACATCATCGTCTTCAAGAGACTGA
Transcript >AgabiH97|100890
ATGGCCACGACTCAGTTCGACCACATCTTCCACAGCCTCGCCCCAGATGTCGGCAAATTTCGTGTCGCACCCAGC
GGCATGGCCTGGAAAGGCTCAGACTCAGAGGCCGTCGTAGCAATGGCTTCTACAGATATCAAGTGGGCTCAATGG
CTTCGGGTCGCCAGGAACTTCCAGCTGCGCGTCGGCATGCGTGATCACCGCAAGGAAAAATTTGACGGCTTCATG
CGAGAGGACCACGATAAACTCGCCTCCTTGCTCAAAAACCATTTTGGAATCACACTAGAAACGCGAGAGGTTTCT
TTTAAAGGGTGGAATTGGGGCGTAACAGACTTCCAAGGCTCGGACCTAGCTTTCATGGTCCAGGACAAAGTAGCA
TTCGAGTTACCTCTACGACACGTCGCGAACTCTAATATTGCCGGTCGAACAGAAGTCTCGCTCGAATTCACCCCT
CTAGGCAAAGGCAGTAAAGCTCTTGGCGATGAGATGATGGAAATTCGCTTCCACGTGCCTGGAACACAGAAATCC
AAGGCCACAGGTTCGGACGCAGGATCCCAAAAGTCTGATGATGAAGAGGACGACATTAGTGCCGCTCAAGTCTTC
CACGATACCATCAAGGAGAAGGCTGAGCTTGGCCAAGTCTCTGGAGATCTCATCCTCAGCTTTGAAGAAATTTTG
GTCCTGACACCTCGTGGTCGTTATGATATGGATATGTCACATGAATATTTGCGTCTGCGCGGAAAAACCTACGAC
TATAAGATCATGTACAATTCCATCTCAAAGCTCTTCTTGCTCCCCAAGGATGACCAACGCGTGCTCTTTATTCTT
GGTCTTAGCATACCCATCAGACAAGGTCAAACCCGCTATCAATACCTTGTGATGCAATTCAGCCGTGAGGAGGAG
ATCACTGCCGAACTTAACATGACTGAGGAGGAAGTTGCCAAATACGATCGCCTAAAGAAAAATTACGAAGACCCT
ACCTTTGAAGTTGTGTCCAGCGTCTTCCGTGCACTGGCGAAGAAAAAGATCGTCGGGGCTGGTAGTTTCCAAAGT
CGAGACGGTCACCCTGGTATCAAAGCCAATCTAAAAGCCATTCAAGGCGATTTATTCCTACTGGAAAAATACATC
TTTTTCGTCTCTAAATCACCCCTCCTAGTCGAAATAGCCGACATTCATCAAGTCGTGTTTTCTCGTGTTGGTGCA
AGCATGGGCGCTGCCGCAGCGCGTACTTTTGATCTAAAAATCGTAACAAAATCTGGAGCAGAGCATACGTTTACG
TCTATCAATAAAGAAGAACATGAGAGTGTTGACGCATATTTGAAGGATAAGAAGATTAAAATAAAGACGGAGACT
GTGCCTGATGTGGATATGATACTAGCTGCGGGTGTTGGGGATGATGATGATGAGGATGATGAAGATATGAGGAGT
ATCGATTCGGACGATGATGGTGGGCGTACTAGAAACAAACCCTCGAAGAAAACTACTGGTAGTGGTGATGGTGAC
GATGATAGCGAGGATGATGAGGACTTTGAAGCATCTGATTCTGACGCGGGATCACCAAGTGATAGTGATTCAGAT
GATTCCGGAGCAGCAACAGCATCAGATGCTAGCGGTGACCTAGCCATCACAGCAGAAAACAGTAACAAAAAAGCT
AAAGGTGCCAAGGGTAAAGGCAAAGCCACTGACGGTACAAAAAAAACCGGCAAGAAGAAGTCGGCGGCAGCAGAG
GAAAGTGATGCGGACGATGATGAAGGAGGCAAGAAGAAAGCAGCGCCTAAACCAAAACCGAAACCAAAACCCAAA
GTAAAATCCGGGGAGGATGAGAATGGAATGGAGGTGGATGACGATGACAAGCCTAAACCGAAGCCTAAACCGAAA
CCAAAACCGAAAGTGAAAGATACCGCTGCTATGGACGTTGATGGTGATGACGGTGGCGACAAGCCCAAGCCCAAG
CCGAAACCGAAACCGAGACCGAGGACAAAGGAGAGTCCCAACGGTGGTGATGGCGATGAAGTCGAGCCGCCTAAA
AAGAAACTCAAAACATCATCGTCTTCAAGAGACTGA
Gene >AgabiH97|100890
ATGGCCACGACTCAGTTCGACCACATCTTCCACAGCCTCGCCCCAGATGTCGGCAGTGAGTACACGCAGTCCTAC
CACCATCTTCGCATCTCAGCATCGCATAGAATTTCGTGTCGCACCCAGCGGCATGGCCTGGAAAGGCTCAGACTC
AGAGGCCGTCGTAGCAATGGCTTCTACAGATATCAAGTGGGCTCAATGGCTTCGGGTCGCCAGGAACTTCCAGCT
GCGCGTCGGCATGCGTGATCACCGCAAGGAAAAATTTGACGGCTTCATGCGAGAGGTAGACCAACTTTGAACCTT
TATAATGTAGGCTAGCGCTTATGAAATCTCAAAGGACCACGATAAACTCGCCTCCTTGCTCAAAAACCATTTTGG
AATCACACTAGAAACGCGAGAGGTTTCTTTTAAAGGGTGGAATTGGGGCGTAACAGACTTCCAAGGTATGGGGGC
GCTGTAATCTTGCCACAGTGATGACTCAAACTGCGCGTAATGTAGGCTCGGACCTAGCTTTCATGGTCCAGGACA
AAGTAGCATTCGAGTTACCTCTACGACACGTCGCGAACTCTAATATTGCCGGTCGAACAGAAGTCTCGCTCGAAT
TCACCCCTCTAGGCAAAGGCAGTAAAGCTCTTGGCGATGAGATGATGGAAATTCGCTTCCACGTGCCTGGAACAC
AGAAATCCAAGGCCACAGGTTCGGACGCAGGATCCCAAAAGTCTGATGATGAAGAGGACGACATTAGTGCCGCTC
AAGTCTTCCACGATACCATCAAGGAGAAGGCTGAGCTTGGCCAAGTCTCTGGAGATCTCATCCTCAGCTTTGAAG
AAATTTTGGTCCTGACACCTCGTGGTCGTTATGATATGGATATGTCACATGAATATTTGCGTCTGCGCGGAAAAA
CCTACGACTATAAGATCATGTACAATTCCATCTCAAAGCTCTTCTTGCTCCCCAAGGATGACCAACGCGTGCTCT
TTATTGTAAGGTTCACTATCTCTTCAGAAGGATGTATTTTGTTGAAATATCTGTCAGCTTGGTCTTAGCATACCC
ATCAGACAAGGTCAAACCCGCTATCAATACCTTGTGATGCAATTCAGCCGTGAGGAGGAGATCACTGCCGAACTT
AACATGACTGAGTGTGTAATGTATACGCCTTTTTCATCTAATGACTGACCGTTCTACCACAGGGAGGAAGTTGCC
AAATACGATCGCCTAAAGAAAAATTACGAAGACCCTACCTTTGAAGTTGTGTCCAGCGTCTTCCGTGCACTGGCG
AAGAAAAAGATCGTCGGGGCTGGTAGTTTCCAAAGGTATGTAAACAAACTTTCCTGTTTCAATCATGCACTGATC
AATTACTTTTGTCGCCGTAGTCGAGACGGTCACCCTGGTATCAAAGCCAATCTAAAAGCCATTCAAGGCGATTTA
TTCCTACTGGAAAAATACATCTTTTTCGTCTCTAAATCACCCCTCCTAGTCGAAATAGCCGACATTCATCAAGTC
GTGTTTTCTCGTGTTGGTGCAAGCATGGGCGCTGCCGCAGCGCGTACTTTTGATCTAAAAATCGTAACAAAATCT
GGAGCAGAGCATACGTTTACGTCTATCAATAAAGAAGAACATGAGAGTGTTGACGCATATTTGAAGGATAAGAAG
ATTAAAATAAAGACGGAGACTGTGCCTGATGTGGATATGATACTAGCTGCGGGTGTTGGGGATGATGATGATGAG
GATGATGAAGATATGAGGAGTATCGATTCGGACGATGATGGTGGGCGTACTAGAAACAAACCCTCGAAGAAAACT
ACTGGTAGTGGTGATGGTGACGATGATAGCGAGGATGATGGTACGTCCGACGATTCTGAGGCAATCATATATATA
CATATGCTCACCACACCTACTATCAAACAGAGGACTTTGAAGCATCTGATTCTGACGCGGGATCACCAAGTGATA
GTGATTCAGATGATTCCGGAGCAGCAACAGCATCAGATGCTAGCGGTGACCTAGCCATCACAGCAGAAAACAGTA
ACAAAAAAGCTAAAGGTGCCAAGGGTAAAGGCAAAGCCACTGACGGTACAAAAAAAACCGGCAAGAAGAAGTCGG
CGGCAGCAGAGGAAAGTGATGCGGACGATGATGAAGGAGGCAAGAAGAAAGCAGCGCCTAAACCAAAACCGAAAC
CAAAACCCAAAGTAAAATCCGGGGAGGATGAGAATGGAATGGAGGTGGATGACGATGACAAGCCTAAACCGAAGC
CTAAACCGAAACCAAAACCGAAAGTGAAAGATACCGCTGCTATGGACGTTGATGGTGATGACGGTGGCGACAAGC
CCAAGCCCAAGCCGAAACCGAAACCGAGACCGAGGACAAAGGAGAGTCCCAACGGTGGTGATGGCGATGAAGTCG
AGCCGCCTAAAAAGAAACTCAAAACATCATCGTCTTCAAGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail