Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|100810
Gene name
Locationscaffold_7:956434..958707
Strand+
Gene length (bp)2273
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03659 Glyco_hydro_71 Glycosyl hydrolase family 71 3.1E-126 135 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 133 303 1.0E-35
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 389 588 3.0E-30
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 395 608 3.0E-27
sp|O94510|AGN2_SCHPO Glucan endo-1,3-alpha-glucosidase agn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn2 PE=2 SV=2 132 315 3.0E-23
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 115 305 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 133 303 1.0E-35
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 389 588 3.0E-30
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 395 608 3.0E-27
sp|O94510|AGN2_SCHPO Glucan endo-1,3-alpha-glucosidase agn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn2 PE=2 SV=2 132 315 3.0E-23
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 115 305 4.0E-21
sp|O94510|AGN2_SCHPO Glucan endo-1,3-alpha-glucosidase agn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn2 PE=2 SV=2 383 568 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0051118 glucan endo-1,3-alpha-glucosidase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003674 molecular_function No
GO:0015926 glucosidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|100810
MPYTTLIVLFIILLSAVHALVVPPRRTTIQRHTRGKAGLLEDLSSISPNLLSNASGTGDFLVVPREQVTPTSVIP
RSSTPIPNTLNSITEATPTHKSSNNSAAPFPSAPPFTATPKASIPLMSTSPVDNSFQKYVVAHHMVGNTYPYTLN
DWADDIRLAHASGIDGFALNCGIDDWSAARVADAYEAAKQSNLDFKLFISLDMTSFPCQSPDDACRLREFIKPYL
DHPNQLRYDSRAFVSTFAGETCTFGQASVQEGWKSQFVQQNDLQGKVYFVPAFFIDPAEFGGFFEVMNGDFNWNS
GWPIELTTSFAHNLVASLSDGTGAATVNKIPSIFQLSNAILGSTFRSLTSAIPALAPVLDEFIKSTETDDEHVKA
LEALRTNIQARDDRAMKPMYMGAVSPWFFTHYGKDSFNKNWIYFSDHHLYVKRWESIVSNRDQFDIIQILTWNDY
GESHYIGPVKGSQPNSEAWVNGFDHTGWLELTRYYASAYKTGIFPAIEKDKIFMWSRPHPSQAKADDPVGQPENF
ELSQDAVWVVVMTTKPSTVILSTSSDAAASQQIQVPLGVSKLSVPITPGGIMKGIIQREGETIVELAPSPEAFTF
QESCCIFSV*
Coding >AgabiH97|100810
ATGCCATATACGACATTGATTGTCCTTTTCATTATCCTTCTCAGTGCTGTGCACGCTTTAGTTGTTCCCCCCAGA
CGGACCACGATTCAAAGGCATACTCGCGGGAAGGCTGGGCTTCTTGAAGATCTCAGTTCCATTTCTCCGAACTTG
TTAAGCAATGCCAGTGGGACTGGGGACTTTCTCGTCGTCCCCAGAGAGCAAGTAACTCCAACGTCTGTTATTCCG
AGGTCCAGCACTCCCATTCCTAATACCTTAAATTCTATAACTGAGGCTACGCCCACGCACAAAAGTTCAAATAAT
TCTGCCGCCCCATTCCCAAGCGCACCTCCTTTTACCGCCACACCCAAAGCTTCGATACCATTGATGTCAACTTCC
CCTGTTGATAACAGTTTTCAAAAATACGTAGTTGCCCACCACATGGTCGGCAATACCTATCCGTATACCTTGAAT
GACTGGGCAGATGATATCAGATTGGCACATGCATCTGGAATTGATGGTTTTGCGCTCAATTGCGGCATCGACGAT
TGGAGTGCCGCCCGTGTCGCCGACGCCTATGAAGCTGCTAAGCAATCTAATCTAGACTTCAAACTATTTATCTCC
CTCGACATGACTTCATTTCCCTGCCAGTCTCCCGATGACGCATGTCGACTGCGTGAATTTATCAAACCCTATTTG
GATCACCCAAACCAGCTTCGATACGATTCTCGTGCGTTCGTCTCGACATTTGCCGGTGAAACATGTACTTTCGGG
CAGGCCTCCGTACAAGAGGGCTGGAAATCACAATTTGTCCAACAAAACGACTTGCAAGGCAAAGTTTACTTTGTA
CCCGCATTTTTTATCGATCCTGCTGAGTTTGGTGGATTTTTCGAGGTGATGAATGGTGATTTCAATTGGAATTCT
GGCTGGCCGATAGAATTGACAACCTCTTTTGCGCATAACCTCGTTGCTTCCCTGTCTGATGGTACGGGAGCTGCC
ACGGTCAACAAAATTCCTTCTATATTTCAATTGTCAAACGCCATTCTCGGATCAACCTTTCGTTCCCTCACATCC
GCTATCCCTGCACTTGCACCTGTGCTGGATGAATTCATTAAATCCACTGAAACGGATGACGAACACGTGAAGGCC
CTTGAAGCTCTTCGCACCAACATTCAGGCTAGAGACGATAGGGCTATGAAACCCATGTACATGGGTGCAGTATCG
CCTTGGTTCTTTACGCACTATGGCAAAGATTCTTTTAACAAGAATTGGATCTATTTCTCGGATCACCATCTCTAT
GTCAAACGTTGGGAATCTATTGTTTCCAACCGAGACCAGTTCGATATCATACAGATTCTTACCTGGAATGATTAT
GGAGAATCGCACTATATCGGGCCCGTCAAGGGTTCCCAGCCAAACAGCGAGGCTTGGGTGAACGGTTTTGATCAC
ACTGGTTGGCTTGAACTCACACGATACTATGCTTCAGCCTATAAGACCGGCATATTCCCTGCAATAGAAAAAGAC
AAGATTTTCATGTGGTCACGGCCTCACCCATCTCAAGCAAAGGCGGATGACCCGGTCGGTCAGCCTGAAAATTTC
GAGCTATCACAGGATGCTGTTTGGGTCGTGGTAATGACTACTAAACCGTCCACTGTTATCCTCTCAACTTCGTCC
GATGCAGCCGCTAGCCAACAAATTCAAGTTCCCTTGGGCGTGTCGAAGCTCTCAGTGCCGATCACACCTGGGGGT
ATCATGAAGGGTATCATTCAGCGAGAGGGGGAGACCATAGTTGAACTGGCACCCTCGCCTGAAGCATTTACGTTT
CAAGAAAGTTGCTGTATCTTTAGTGTATGA
Transcript >AgabiH97|100810
ATGCCATATACGACATTGATTGTCCTTTTCATTATCCTTCTCAGTGCTGTGCACGCTTTAGTTGTTCCCCCCAGA
CGGACCACGATTCAAAGGCATACTCGCGGGAAGGCTGGGCTTCTTGAAGATCTCAGTTCCATTTCTCCGAACTTG
TTAAGCAATGCCAGTGGGACTGGGGACTTTCTCGTCGTCCCCAGAGAGCAAGTAACTCCAACGTCTGTTATTCCG
AGGTCCAGCACTCCCATTCCTAATACCTTAAATTCTATAACTGAGGCTACGCCCACGCACAAAAGTTCAAATAAT
TCTGCCGCCCCATTCCCAAGCGCACCTCCTTTTACCGCCACACCCAAAGCTTCGATACCATTGATGTCAACTTCC
CCTGTTGATAACAGTTTTCAAAAATACGTAGTTGCCCACCACATGGTCGGCAATACCTATCCGTATACCTTGAAT
GACTGGGCAGATGATATCAGATTGGCACATGCATCTGGAATTGATGGTTTTGCGCTCAATTGCGGCATCGACGAT
TGGAGTGCCGCCCGTGTCGCCGACGCCTATGAAGCTGCTAAGCAATCTAATCTAGACTTCAAACTATTTATCTCC
CTCGACATGACTTCATTTCCCTGCCAGTCTCCCGATGACGCATGTCGACTGCGTGAATTTATCAAACCCTATTTG
GATCACCCAAACCAGCTTCGATACGATTCTCGTGCGTTCGTCTCGACATTTGCCGGTGAAACATGTACTTTCGGG
CAGGCCTCCGTACAAGAGGGCTGGAAATCACAATTTGTCCAACAAAACGACTTGCAAGGCAAAGTTTACTTTGTA
CCCGCATTTTTTATCGATCCTGCTGAGTTTGGTGGATTTTTCGAGGTGATGAATGGTGATTTCAATTGGAATTCT
GGCTGGCCGATAGAATTGACAACCTCTTTTGCGCATAACCTCGTTGCTTCCCTGTCTGATGGTACGGGAGCTGCC
ACGGTCAACAAAATTCCTTCTATATTTCAATTGTCAAACGCCATTCTCGGATCAACCTTTCGTTCCCTCACATCC
GCTATCCCTGCACTTGCACCTGTGCTGGATGAATTCATTAAATCCACTGAAACGGATGACGAACACGTGAAGGCC
CTTGAAGCTCTTCGCACCAACATTCAGGCTAGAGACGATAGGGCTATGAAACCCATGTACATGGGTGCAGTATCG
CCTTGGTTCTTTACGCACTATGGCAAAGATTCTTTTAACAAGAATTGGATCTATTTCTCGGATCACCATCTCTAT
GTCAAACGTTGGGAATCTATTGTTTCCAACCGAGACCAGTTCGATATCATACAGATTCTTACCTGGAATGATTAT
GGAGAATCGCACTATATCGGGCCCGTCAAGGGTTCCCAGCCAAACAGCGAGGCTTGGGTGAACGGTTTTGATCAC
ACTGGTTGGCTTGAACTCACACGATACTATGCTTCAGCCTATAAGACCGGCATATTCCCTGCAATAGAAAAAGAC
AAGATTTTCATGTGGTCACGGCCTCACCCATCTCAAGCAAAGGCGGATGACCCGGTCGGTCAGCCTGAAAATTTC
GAGCTATCACAGGATGCTGTTTGGGTCGTGGTAATGACTACTAAACCGTCCACTGTTATCCTCTCAACTTCGTCC
GATGCAGCCGCTAGCCAACAAATTCAAGTTCCCTTGGGCGTGTCGAAGCTCTCAGTGCCGATCACACCTGGGGGT
ATCATGAAGGGTATCATTCAGCGAGAGGGGGAGACCATAGTTGAACTGGCACCCTCGCCTGAAGCATTTACGTTT
CAAGAAAGTTGCTGTATCTTTAGTGTATGA
Gene >AgabiH97|100810
ATGCCATATACGACATTGATTGTCCTTTTCATTATCCTTCTCAGTGCTGTGCACGCTTTAGTTGTTCCCCCCAGA
CGGACCACGATTCAAAGGCATACTCGCGGGAAGGCTGGGCTTCTTGAAGATCTCAGTTCCATTTCTCCGAACTTG
TTAAGCAATGCCAGTGGGACTGGGGACTTTCTCGTCGTCCCCAGAGAGCAAGTAACTCCAACGTCTGTTATTCCG
AGGTCCAGCACTCCCATTCCTAATACCTTAAATTCTATAACTGAGGCTACGCCCACGCACAAAAGTTCAAATAAT
TCTGCCGCCCCATTCCCAAGCGCACCTCCTTTTACCGCCACACCCAAAGCTTCGATACCATTGATGTCAACTTCC
CCTGTTGATAACAGTTTTCAAAAATACGTAGTTGCCCACCACATGGTCGGCAATACCTATCCGTATACCTTGAAT
GACTGGGCAGATGATATCAGATTGGCACATGCATCTGGAATTGATGGTTTTGCGCTCAATTGCGGCATCGACGAT
TGGAGTGCCGCCCGTGTCGCCGACGCGTAAGTTGCATCCTTCCTCCTTCATGTACAATACGCTAATTCCCTCGTA
GCTATGAAGCTGCTAAGCAATCTAATCTAGACTTCAAACTATTTATCTCCCTCGACATGACGTAGGTCTTTTTTC
CTATCCTTTTAGTTGCATCACTCTAACTTCATATCTCAAGTTCATTTCCCTGCCAGTCTCCCGATGACGCATGTC
GACTGCGTGAATTTATCAAACCCTATTTGGATCACCCAAACCAGCTTCGATACGATTCTCGTGCGTTCGTCTCGA
CATTTGCCGGTGAAACATGTACTTTCGGGCAGGCCTCCGTACAAGAGGGCTGGAAATCACAATTTGTCCAACAAA
ACGACTTGCAAGGCAAAGTTTACTTTGTACCCGCATTTTTTATCGATCCTGCTGAGTTTGGTGGATTTTTCGAGG
TGATGAATGGTGATTTCAATGTGATTCTACCCTGTAATCAATTGGAGCCGGGACTGATATTTGCGACAGTGGAAT
TCTGGCTGGCCGATAGAATTGACAACCTCTTTTGCGCATAACCTCGTTGCTTCCCTGTCTGATGGTACGGGAGCT
GCCACGGTCAACAAAATTCCTTCTATATTTCAATTGTCAAACGCCATTCTCGGATCAACCTTTCGTTCCCTCACA
TCCGCTATCCCTGCACTTGCACCTGTGCTGGATGAATTCATTAAATCCACTGAAACGGATGACGAACACGTGAAG
GCCCTTGAAGCTCTTCGCACCAACATTCAGGCTAGAGACGATAGGGCTATGAAACCCATGTACATGGGTGCAGTA
TCGCCTTGGTTCTTTACGCACTATGGCAAAGATTCTTTTAACAAGAATGTAAGAGCAAGAAATTTTACCATTAAT
CCGCTGATATGTGTATACTGATCGAGTTGTGGCGTTATAGTGGATCTATTTCTCGGATCACCATCTCTATGTCAA
ACGTTGGGAATCTATTGTTTCCAACCGAGACCAGTTCGATATCATACAGATTCTTACCTGGAATGATTATGGAGA
ATCGCACTATATCGGGCCCGTCAAGGGTTCCCAGCCAAACAGCGAGGCTTGGGTGAACGGTTTTGATCACACTGG
TAAGTGTTAAATATCTGTATTCTCCTCTCGAATTAAAATAATCGAAAGCGTATGCTAGGTTGGCTTGAACTCACA
CGATACTATGCTTCAGCCTATAAGACCGGCATATTCCCTGCAATAGAAAAAGACAAGATTTTCATGTGGTCACGG
CCTCACCCATCTCAAGCAAAGGCGGATGACCCGGTCGGTCAGCCTGAAAATTTCGAGCTAGTACGTTCCCTTCCC
ACAAATTTCTCGGCTGATGTAAAGAACTTATGCGCGCAATCAGTCACAGGATGCTGTTTGGGTCGTGGTAATGAC
TACTAAACCGTCCACTGTTATCCTCTCAACTTCGTCCGATGCAGCCGCTAGCCAACAAATTCAAGTTCCCTTGGG
CGTGTCGAAGCTCTCAGTGCCGATCACACCTGGGGGTATCATGAAGGGTATCATTCAGCGAGAGGGGGAGACCAT
AGTTGAACTGGCACCCTCGCCTGAAGCATTTACGTTTCAAGGTTCCCCGGCTTCGTATAATTTCAATGCGTTTGT
AGCTAGTGCCATAGCTAATTAGAAAGGTGTGTTTCTATCCGCTTACTCGTCAATTAAATTAATGTGATATGTTTA
GTTGCTGTATCTTTAGTGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail