Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|100120
Gene name
Locationscaffold_7:795694..796543
Strand-
Gene length (bp)849
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00959 Phage_lysozyme Phage lysozyme 4.2E-13 133 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ATA2|A7466_ARTBC Uncharacterized secreted protein ARB_07466 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07466 PE=1 SV=1 4 97 2.0E-22
sp|P11187|LYS_BPPH2 Lysozyme OS=Bacillus phage phi29 GN=15 PE=3 SV=1 107 253 3.0E-18
sp|P07540|LYS_BPPZA Lysozyme OS=Bacillus phage PZA GN=15 PE=3 SV=1 107 253 5.0E-18
sp|Q37896|LYS_BPB03 Lysozyme OS=Bacillus phage B103 GN=15 PE=3 SV=1 107 258 4.0E-17
sp|Q9T1T5|LYS_BPAPS Probable lysozyme OS=Acyrthosiphon pisum secondary endosymbiont phage 1 GN=13 PE=3 SV=1 114 256 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ATA2|A7466_ARTBC Uncharacterized secreted protein ARB_07466 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07466 PE=1 SV=1 4 97 2.0E-22
sp|P11187|LYS_BPPH2 Lysozyme OS=Bacillus phage phi29 GN=15 PE=3 SV=1 107 253 3.0E-18
sp|P07540|LYS_BPPZA Lysozyme OS=Bacillus phage PZA GN=15 PE=3 SV=1 107 253 5.0E-18
sp|Q37896|LYS_BPB03 Lysozyme OS=Bacillus phage B103 GN=15 PE=3 SV=1 107 258 4.0E-17
sp|Q9T1T5|LYS_BPAPS Probable lysozyme OS=Acyrthosiphon pisum secondary endosymbiont phage 1 GN=13 PE=3 SV=1 114 256 1.0E-12
sp|O80292|LYS_BPPS1 Lysozyme OS=Bacteriophage PS119 GN=19 PE=3 SV=1 118 249 5.0E-11
sp|P62693|LYS_BPPHV Lysozyme OS=Lactococcus phage phivML3 GN=L3 PE=3 SV=1 112 253 1.0E-09
sp|P62692|LYS_BPLC2 Lysozyme OS=Lactococcus phage c2 GN=L3 PE=3 SV=1 112 253 1.0E-09
sp|P78285|LYSD_ECOLI Lysozyme RrrD OS=Escherichia coli (strain K12) GN=rrrD PE=1 SV=1 118 249 2.0E-09
sp|P27359|LYS_BPP21 Lysozyme OS=Enterobacteria phage P21 GN=R PE=1 SV=1 118 249 5.0E-09
sp|P09963|ENLYS_BPP22 Endolysin OS=Enterobacteria phage P22 GN=19 PE=1 SV=1 112 253 1.0E-08
sp|P10439|LYS_BPPA2 Lysozyme OS=Enterobacteria phage PA-2 GN=15 PE=3 SV=1 118 249 2.0E-08
sp|O80288|LYS_BPPS3 Lysozyme OS=Bacteriophage PS34 GN=19 PE=3 SV=1 118 249 3.0E-08
sp|Q9T1X2|ENLYS_BPMU Endolysin OS=Enterobacteria phage Mu GN=lys PE=2 SV=1 117 253 3.0E-07
sp|P51728|LYS_BPHC1 Lysozyme OS=Haemophilus phage HP1 (strain HP1c1) GN=lys PE=3 SV=1 105 252 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0009253 peptidoglycan catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:1901575 organic substance catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0006026 aminoglycan catabolic process No
GO:0016787 hydrolase activity No
GO:0006022 aminoglycan metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006807 nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0003674 molecular_function No
GO:0044036 cell wall macromolecule metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0009987 cellular process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0003824 catalytic activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 11.56 3.94 19.18
Initials Initials knots 4.89 1.80 7.99
Pileal_Stipeal_center Stage I stipe center 4.38 1.59 7.16
Pileal_Stipeal_shell Stage I stipe shell 7.08 2.96 11.21
DIF_stipe_center Stage II stipe center 3.94 1.40 6.47
DIF_stipe_shell Stage II stipe shell 3.87 1.33 6.41
DIF_stipe_skin Stage II stipe skin 2.82 0.86 4.79
DIF_cap_skin Stage II cap skin 5.86 2.32 9.41
DIF_cap_tissue Stage II cap tissue 5.87 2.36 9.38
DIF_gill_tissue Stage II gill tissue 6.24 2.54 9.93
YFB_stipe_center Young fruiting body stipe center 4.48 1.62 7.34
YFB_stipe_shell Young fruiting body stipe shell 3.76 1.34 6.17
YFB_stipe_skin Young fruiting body stipe skin 4.56 1.66 7.46
YFB_cap_skin Young fruiting body cap skin 4.51 1.63 7.40
YFB_cap_tissue Young fruiting body cap tissue 6.05 2.42 9.68
YFB_gill_tissue Young fruiting body gill tissue 4.77 1.67 7.88
YFB_veil Young fruiting body veil 5.55 2.15 8.94

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.170359 no
Casing YFB_stipe_center 0.019442 yes
Casing YFB_stipe_shell 0.006032 yes
Casing YFB_stipe_skin 0.023415 yes
Casing YFB_cap_skin 0.022111 yes
Casing YFB_cap_tissue 0.148373 no
Casing YFB_gill_tissue 0.041603 yes
Casing YFB_veil 0.087416 no
Casing Initials 0.043339 yes
Casing Pileal_Stipeal_center 0.020790 yes
Casing Pileal_Stipeal_shell 0.296701 no
Casing DIF_stipe_center 0.009123 yes
Casing DIF_stipe_shell 0.006742 yes
Casing DIF_stipe_skin 0.001625 yes
Casing DIF_cap_skin 0.116571 no
Casing DIF_cap_tissue 0.120821 no
DIF_gill_tissue YFB_stipe_center 0.562644 no
DIF_gill_tissue YFB_stipe_shell 0.294143 no
DIF_gill_tissue YFB_stipe_skin 0.584608 no
DIF_gill_tissue YFB_cap_skin 0.571885 no
DIF_gill_tissue YFB_cap_tissue 0.970950 no
DIF_gill_tissue YFB_gill_tissue 0.671264 no
DIF_gill_tissue YFB_veil 0.873854 no
YFB_stipe_center YFB_stipe_shell 0.807607 no
YFB_stipe_center YFB_stipe_skin 0.984605 no
YFB_stipe_center YFB_cap_skin 0.992129 no
YFB_stipe_center YFB_cap_tissue 0.607681 no
YFB_stipe_center YFB_gill_tissue 0.943135 no
YFB_stipe_center YFB_veil 0.746751 no
YFB_stipe_shell YFB_stipe_skin 0.780903 no
YFB_stipe_shell YFB_cap_skin 0.794256 no
YFB_stipe_shell YFB_cap_tissue 0.330386 no
YFB_stipe_shell YFB_gill_tissue 0.721456 no
YFB_stipe_shell YFB_veil 0.463813 no
YFB_stipe_skin YFB_cap_skin 0.990086 no
YFB_stipe_skin YFB_cap_tissue 0.633834 no
YFB_stipe_skin YFB_gill_tissue 0.959769 no
YFB_stipe_skin YFB_veil 0.769622 no
YFB_cap_skin YFB_cap_tissue 0.621727 no
YFB_cap_skin YFB_gill_tissue 0.951460 no
YFB_cap_skin YFB_veil 0.760901 no
YFB_cap_tissue YFB_gill_tissue 0.714508 no
YFB_cap_tissue YFB_veil 0.910430 no
YFB_gill_tissue YFB_veil 0.842619 no
Initials DIF_gill_tissue 0.702845 no
Initials YFB_stipe_center 0.917576 no
Initials YFB_stipe_shell 0.678270 no
Initials YFB_stipe_skin 0.935680 no
Initials YFB_cap_skin 0.924048 no
Initials YFB_cap_tissue 0.752354 no
Initials YFB_gill_tissue 0.978597 no
Initials YFB_veil 0.870218 no
Initials Pileal_Stipeal_center 0.892176 no
Initials Pileal_Stipeal_shell 0.484405 no
Initials DIF_stipe_center 0.752092 no
Initials DIF_stipe_shell 0.726970 no
Initials DIF_stipe_skin 0.290256 no
Initials DIF_cap_skin 0.795954 no
Initials DIF_cap_tissue 0.795220 no
Pileal_Stipeal_center DIF_gill_tissue 0.517682 no
Pileal_Stipeal_center YFB_stipe_center 0.979616 no
Pileal_Stipeal_center YFB_stipe_shell 0.838159 no
Pileal_Stipeal_center YFB_stipe_skin 0.963114 no
Pileal_Stipeal_center YFB_cap_skin 0.971675 no
Pileal_Stipeal_center YFB_cap_tissue 0.569651 no
Pileal_Stipeal_center YFB_gill_tissue 0.919692 no
Pileal_Stipeal_center YFB_veil 0.710508 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.309634 no
Pileal_Stipeal_center DIF_stipe_center 0.895323 no
Pileal_Stipeal_center DIF_stipe_shell 0.873766 no
Pileal_Stipeal_center DIF_stipe_skin 0.431979 no
Pileal_Stipeal_center DIF_cap_skin 0.619957 no
Pileal_Stipeal_center DIF_cap_tissue 0.621124 no
Pileal_Stipeal_shell DIF_gill_tissue 0.856656 no
Pileal_Stipeal_shell YFB_stipe_center 0.346713 no
Pileal_Stipeal_shell YFB_stipe_shell 0.141124 no
Pileal_Stipeal_shell YFB_stipe_skin 0.370347 no
Pileal_Stipeal_shell YFB_cap_skin 0.361031 no
Pileal_Stipeal_shell YFB_cap_tissue 0.816567 no
Pileal_Stipeal_shell YFB_gill_tissue 0.455042 no
Pileal_Stipeal_shell YFB_veil 0.681117 no
Pileal_Stipeal_shell DIF_stipe_center 0.188282 no
Pileal_Stipeal_shell DIF_stipe_shell 0.161831 no
Pileal_Stipeal_shell DIF_stipe_skin 0.035765 yes
Pileal_Stipeal_shell DIF_cap_skin 0.766629 no
Pileal_Stipeal_shell DIF_cap_tissue 0.770809 no
DIF_stipe_center DIF_gill_tissue 0.361539 no
DIF_stipe_center YFB_stipe_center 0.872062 no
DIF_stipe_center YFB_stipe_shell 0.956653 no
DIF_stipe_center YFB_stipe_skin 0.849214 no
DIF_stipe_center YFB_cap_skin 0.858905 no
DIF_stipe_center YFB_cap_tissue 0.404519 no
DIF_stipe_center YFB_gill_tissue 0.790718 no
DIF_stipe_center YFB_veil 0.545080 no
DIF_stipe_center DIF_stipe_shell 0.983934 no
DIF_stipe_center DIF_stipe_skin 0.594591 no
DIF_stipe_center DIF_cap_skin 0.454283 no
DIF_stipe_center DIF_cap_tissue 0.455910 no
DIF_stipe_shell DIF_gill_tissue 0.324416 no
DIF_stipe_shell YFB_stipe_center 0.848329 no
DIF_stipe_shell YFB_stipe_shell 0.972656 no
DIF_stipe_shell YFB_stipe_skin 0.823100 no
DIF_stipe_shell YFB_cap_skin 0.833635 no
DIF_stipe_shell YFB_cap_tissue 0.369030 no
DIF_stipe_shell YFB_gill_tissue 0.764433 no
DIF_stipe_shell YFB_veil 0.508032 no
DIF_stipe_shell DIF_stipe_skin 0.614639 no
DIF_stipe_shell DIF_cap_skin 0.415001 no
DIF_stipe_shell DIF_cap_tissue 0.416582 no
DIF_stipe_skin DIF_gill_tissue 0.078590 no
DIF_stipe_skin YFB_stipe_center 0.399688 no
DIF_stipe_skin YFB_stipe_shell 0.660730 no
DIF_stipe_skin YFB_stipe_skin 0.374726 no
DIF_stipe_skin YFB_cap_skin 0.390721 no
DIF_stipe_skin YFB_cap_tissue 0.094162 no
DIF_stipe_skin YFB_gill_tissue 0.329583 no
DIF_stipe_skin YFB_veil 0.147817 no
DIF_stipe_skin DIF_cap_skin 0.106349 no
DIF_stipe_skin DIF_cap_tissue 0.106812 no
DIF_cap_skin DIF_gill_tissue 0.938417 no
DIF_cap_skin YFB_stipe_center 0.661113 no
DIF_cap_skin YFB_stipe_shell 0.374244 no
DIF_cap_skin YFB_stipe_skin 0.684104 no
DIF_cap_skin YFB_cap_skin 0.667525 no
DIF_cap_skin YFB_cap_tissue 0.968647 no
DIF_cap_skin YFB_gill_tissue 0.763178 no
DIF_cap_skin YFB_veil 0.946641 no
DIF_cap_skin DIF_cap_tissue 0.996550 no
DIF_cap_tissue DIF_gill_tissue 0.938259 no
DIF_cap_tissue YFB_stipe_center 0.658135 no
DIF_cap_tissue YFB_stipe_shell 0.377188 no
DIF_cap_tissue YFB_stipe_skin 0.682658 no
DIF_cap_tissue YFB_cap_skin 0.665704 no
DIF_cap_tissue YFB_cap_tissue 0.970292 no
DIF_cap_tissue YFB_gill_tissue 0.760394 no
DIF_cap_tissue YFB_veil 0.943093 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|100120
MLKTLSILFVSVGLAQAAVNGVCSVNGTPGVCIDTSICSSGGGTSASGFCPNDPSNIRCCTKTSCSTGGNCRWTS
QCASGNTVSGFCPGPADFKCCLGSSGCAAHAVNTATINLIKEFEGFVPSPAPDPIGLPTVGYGHLCRNSGCSEVP
FSFPLSTTTATTLLHSDLVTFQNCITADVNDNIRLNANQYGALVSWAFNEGCGAAGSSTLIARLNNGEDPNTVAA
QELPKWVFAGGQVLPGLVRRRDAEIALFRTASSVIANPPC*
Coding >AgabiH97|100120
ATGTTGAAAACTCTTTCTATTCTGTTCGTCTCTGTTGGTCTTGCCCAGGCTGCTGTGAATGGAGTTTGCTCCGTT
AACGGCACCCCAGGAGTTTGCATCGACACTTCTATTTGCAGCTCAGGTGGCGGTACATCCGCCTCTGGCTTTTGT
CCCAATGATCCTAGCAATATCAGGTGCTGCACTAAAACTTCATGCAGCACTGGCGGTAACTGCCGCTGGACTAGC
CAGTGCGCCAGTGGTAACACCGTATCAGGCTTTTGCCCTGGTCCCGCCGACTTCAAGTGCTGTCTAGGCAGCTCA
GGCTGTGCAGCCCACGCGGTCAACACTGCTACAATCAACCTCATTAAGGAATTCGAGGGCTTTGTACCCAGTCCC
GCTCCTGATCCAATCGGCCTTCCCACTGTCGGTTACGGTCATCTCTGTCGCAACTCTGGCTGTAGCGAAGTACCC
TTCTCCTTCCCTCTCTCCACCACCACTGCCACCACTCTCTTGCATTCGGACTTGGTGACCTTCCAAAACTGTATC
ACCGCCGACGTCAATGATAACATCCGACTCAACGCAAATCAATACGGAGCTCTCGTGTCTTGGGCCTTCAATGAA
GGATGCGGTGCTGCAGGCAGTTCCACTTTGATTGCCAGACTCAATAACGGGGAAGACCCAAATACCGTTGCTGCG
CAGGAGTTGCCGAAATGGGTGTTCGCTGGTGGACAAGTATTACCCGGACTGGTCAGGCGTAGGGACGCTGAAATT
GCTTTGTTCAGGACTGCTTCGAGTGTTATTGCTAACCCACCTTGCTAG
Transcript >AgabiH97|100120
ATGTTGAAAACTCTTTCTATTCTGTTCGTCTCTGTTGGTCTTGCCCAGGCTGCTGTGAATGGAGTTTGCTCCGTT
AACGGCACCCCAGGAGTTTGCATCGACACTTCTATTTGCAGCTCAGGTGGCGGTACATCCGCCTCTGGCTTTTGT
CCCAATGATCCTAGCAATATCAGGTGCTGCACTAAAACTTCATGCAGCACTGGCGGTAACTGCCGCTGGACTAGC
CAGTGCGCCAGTGGTAACACCGTATCAGGCTTTTGCCCTGGTCCCGCCGACTTCAAGTGCTGTCTAGGCAGCTCA
GGCTGTGCAGCCCACGCGGTCAACACTGCTACAATCAACCTCATTAAGGAATTCGAGGGCTTTGTACCCAGTCCC
GCTCCTGATCCAATCGGCCTTCCCACTGTCGGTTACGGTCATCTCTGTCGCAACTCTGGCTGTAGCGAAGTACCC
TTCTCCTTCCCTCTCTCCACCACCACTGCCACCACTCTCTTGCATTCGGACTTGGTGACCTTCCAAAACTGTATC
ACCGCCGACGTCAATGATAACATCCGACTCAACGCAAATCAATACGGAGCTCTCGTGTCTTGGGCCTTCAATGAA
GGATGCGGTGCTGCAGGCAGTTCCACTTTGATTGCCAGACTCAATAACGGGGAAGACCCAAATACCGTTGCTGCG
CAGGAGTTGCCGAAATGGGTGTTCGCTGGTGGACAAGTATTACCCGGACTGGTCAGGCGTAGGGACGCTGAAATT
GCTTTGTTCAGGACTGCTTCGAGTGTTATTGCTAACCCACCTTGCTAG
Gene >AgabiH97|100120
ATGTTGAAAACTCTTTCTATTCTGTTCGTCTCTGTTGGTCTTGCCCAGGCTGCTGTGAATGGAGTTTGCTCCGTT
AACGGCACCCCAGGAGTTTGCATCGACACTTCTATTTGCAGCTCAGGTGGCGGTACATCCGCCTCTGGCTTTTGT
CCCAATGATCCTAGCAATATCAGGTGCTGCACTAAAACTTCATGCAGCACTGGCGGTAACTGCCGCTGGACTAGC
CAGTGCGCCAGTGGTAACACCGTATCAGGTTTGTCCATTTTTTATACACTTTTATAATAATGATTGAATATATTG
GTAGGCTTTTGCCCTGGTCCCGCCGACTTCAAGTGCTGTCTAGGCAGCTCAGGCTGTGCAGCCCACGCGGTCAAC
ACTGCTACAATCAACCTCATTAAGGAATTCGAGGGCTTTGTACCCAGTCCCGCTCCTGATCCAATCGGCCTTCCC
ACTGTCGGTTACGGTCATCTCTGTCGCAACTCTGGCTGTAGCGAAGTACCCTTCTCCTTCCCTCTCTCCACCACC
ACTGCCACCACTCTCTTGCATTCGGACTTGGTGACCTTCCAAAACTGTATCACCGCCGACGTCAATGATAACATC
CGACTCAACGCAAATCAATACGGAGCTCTCGTGTCTTGGGCCTTCAATGAAGGATGCGGTGCTGCAGGCAGTTCC
ACTTTGATTGCCAGACTCAATAACGGGGAAGACCCAAATACCGTTGCTGCGCAGGAGTTGCCGAAATGGGTGTTC
GCTGGTGGACAAGTATTACCCGGACTGGTCAGGCGTAGGGACGCTGAAATTGCTTTGTTCAGGACTGCTTCGAGT
GTTATTGCTAACCCACCTTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail