Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|100060
Gene name
Locationscaffold_7:782525..785299
Strand-
Gene length (bp)2774
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01423 LSM LSM domain 1.2E-16 594 652
PF13649 Methyltransf_25 Methyltransferase domain 4.3E-11 240 339
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 9.4E-11 237 312
PF08241 Methyltransf_11 Methyltransferase domain 4.6E-09 241 341
PF13489 Methyltransf_23 Methyltransferase domain 1.4E-07 225 306
PF13847 Methyltransf_31 Methyltransferase domain 6.4E-08 239 349
PF05175 MTS Methyltransferase small domain 8.9E-06 236 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 26 545 3.0E-98
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 32 555 7.0E-95
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 32 555 9.0E-94
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 30 557 4.0E-89
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 184 561 3.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 26 545 3.0E-98
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 32 555 7.0E-95
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 32 555 9.0E-94
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 30 557 4.0E-89
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 184 561 3.0E-81
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 186 553 2.0E-75
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 195 547 2.0E-74
sp|Q54EF2|ANM1_DICDI Protein arginine N-methyltransferase 1 OS=Dictyostelium discoideum GN=prmt1 PE=3 SV=1 200 563 4.0E-73
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 196 545 5.0E-72
sp|O82210|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2 OS=Arabidopsis thaliana GN=PRMT12 PE=1 SV=1 200 549 1.0E-71
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 196 545 3.0E-71
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 187 549 2.0E-70
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 200 549 3.0E-70
sp|A2Z0C0|ANM1_ORYSI Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. indica GN=PRMT1 PE=3 SV=1 200 549 3.0E-70
sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens GN=PRMT1 PE=1 SV=2 200 545 5.0E-69
sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 145 542 5.0E-69
sp|Q63009|ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus GN=Prmt1 PE=1 SV=1 200 545 8.0E-69
sp|Q9JIF0|ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus GN=Prmt1 PE=1 SV=1 200 545 1.0E-68
sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 200 545 1.0E-68
sp|Q5RGQ2|ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio GN=prmt8b PE=2 SV=2 193 542 2.0E-68
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 158 548 2.0E-68
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 200 545 3.0E-68
sp|Q9NR22|ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens GN=PRMT8 PE=1 SV=2 193 565 5.0E-67
sp|Q6PAK3|ANM8_MOUSE Protein arginine N-methyltransferase 8 OS=Mus musculus GN=Prmt8 PE=1 SV=2 193 565 6.0E-67
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 196 547 3.0E-61
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 196 547 3.0E-61
sp|Q0WVD6|ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana GN=PRMT3 PE=2 SV=1 32 528 6.0E-58
sp|P55345|ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens GN=PRMT2 PE=1 SV=1 174 549 3.0E-56
sp|A3BMN9|ANM3_ORYSJ Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. japonica GN=PRMT3 PE=2 SV=1 52 520 7.0E-56
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 197 549 2.0E-55
sp|A2YP56|ANM3_ORYSI Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. indica GN=PRMT3 PE=3 SV=1 52 520 3.0E-55
sp|Q96LA8|ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens GN=PRMT6 PE=1 SV=1 190 549 1.0E-54
sp|Q6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus GN=Prmt6 PE=1 SV=2 190 549 2.0E-54
sp|Q9R144|ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus GN=Prmt2 PE=1 SV=1 186 539 2.0E-54
sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 196 549 5.0E-51
sp|Q68EZ3|ANM6_XENLA Protein arginine N-methyltransferase 6 OS=Xenopus laevis GN=prmt6 PE=2 SV=1 196 549 7.0E-51
sp|Q5E9L5|ANM6_BOVIN Protein arginine N-methyltransferase 6 OS=Bos taurus GN=PRMT6 PE=2 SV=1 198 549 4.0E-49
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 198 549 1.0E-47
sp|Q54HI0|ANM2_DICDI Protein arginine N-methyltransferase 2 OS=Dictyostelium discoideum GN=prmt2 PE=3 SV=1 197 444 3.0E-47
sp|D9IVE5|ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis GN=prmt2 PE=1 SV=2 198 549 3.0E-45
sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 197 556 2.0E-44
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 197 547 9.0E-44
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 197 547 9.0E-44
sp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana GN=PRMT13 PE=2 SV=3 199 545 6.0E-42
sp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. japonica GN=CARM1 PE=2 SV=1 199 538 9.0E-41
sp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. indica GN=CARM1 PE=3 SV=2 199 538 9.0E-41
sp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana GN=PRMT14 PE=1 SV=1 176 545 1.0E-40
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 183 543 2.0E-37
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 201 543 3.0E-36
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 201 543 4.0E-36
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 201 543 6.0E-36
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 185 546 2.0E-35
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 201 543 2.0E-35
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 126 379 4.0E-33
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 126 379 4.0E-33
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 127 379 8.0E-33
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 185 379 1.0E-32
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 185 379 2.0E-32
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 185 379 2.0E-32
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 185 379 2.0E-32
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 127 379 2.0E-32
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 127 379 2.0E-32
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 185 379 3.0E-32
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 185 379 3.0E-32
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 201 545 2.0E-29
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 185 545 3.0E-29
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 201 374 2.0E-28
sp|P62309|RUXG_MOUSE Small nuclear ribonucleoprotein G OS=Mus musculus GN=Snrpg PE=1 SV=1 587 652 8.0E-20
sp|P62308|RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens GN=SNRPG PE=1 SV=1 587 652 8.0E-20
sp|Q3ZBL0|RUXG_BOVIN Small nuclear ribonucleoprotein G OS=Bos taurus GN=SNRPG PE=3 SV=1 587 652 8.0E-20
sp|O74966|RUXG_SCHPO Small nuclear ribonucleoprotein G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smg1 PE=1 SV=1 587 652 3.0E-19
sp|Q9VXE0|RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster GN=SNRPG PE=1 SV=1 587 652 1.0E-18
sp|A8MWD9|RUXGL_HUMAN Putative small nuclear ribonucleoprotein G-like protein 15 OS=Homo sapiens GN=SNRPGP15 PE=5 SV=2 587 652 3.0E-17
sp|P40204|RUXG_YEAST Small nuclear ribonucleoprotein G OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMX2 PE=1 SV=1 591 652 4.0E-17
sp|Q9N4G9|RUXG_CAEEL Probable small nuclear ribonucleoprotein G OS=Caenorhabditis elegans GN=snr-7 PE=3 SV=1 587 652 5.0E-15
sp|Q54RX0|RUXG_DICDI Probable small nuclear ribonucleoprotein G OS=Dictyostelium discoideum GN=snrpG PE=3 SV=1 586 652 1.0E-14
sp|Q582G4|ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PRMT7 PE=1 SV=1 206 377 3.0E-14
sp|O82221|RUXG_ARATH Probable small nuclear ribonucleoprotein G OS=Arabidopsis thaliana GN=At2g23930 PE=2 SV=1 587 652 8.0E-14
sp|P24715|RUXG_MEDSA Probable small nuclear ribonucleoprotein G OS=Medicago sativa GN=C29 PE=3 SV=1 587 652 1.0E-13
sp|A6QQV6|ANM7_BOVIN Protein arginine N-methyltransferase 7 OS=Bos taurus GN=PRMT7 PE=2 SV=1 196 520 6.0E-13
sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 196 517 1.0E-12
sp|Q922X9|ANM7_MOUSE Protein arginine N-methyltransferase 7 OS=Mus musculus GN=Prmt7 PE=1 SV=1 196 523 1.0E-12
sp|Q9NVM4|ANM7_HUMAN Protein arginine N-methyltransferase 7 OS=Homo sapiens GN=PRMT7 PE=1 SV=1 196 525 2.0E-11
sp|Q99MI9|ANM7_CRILO Protein arginine N-methyltransferase 7 OS=Cricetulus longicaudatus GN=Prmt7 PE=1 SV=3 196 523 4.0E-11
sp|Q6PCI6|ANM7_XENLA Protein arginine N-methyltransferase 7 OS=Xenopus laevis GN=prmt7 PE=2 SV=1 196 519 2.0E-10
sp|Q5ZIB9|ANM7_CHICK Protein arginine N-methyltransferase 7 OS=Gallus gallus GN=PRMT7 PE=2 SV=1 183 359 2.0E-10
sp|Q6P2P2|ANM9_HUMAN Putative protein arginine N-methyltransferase 9 OS=Homo sapiens GN=PRMT9 PE=2 SV=1 211 335 3.0E-09
sp|Q3U3W5|ANM9_MOUSE Putative protein arginine N-methyltransferase 9 OS=Mus musculus GN=Prmt9 PE=2 SV=2 211 335 2.0E-08
sp|A0JMU5|ANM9_XENLA Putative protein arginine N-methyltransferase 9 OS=Xenopus laevis GN=prmt9 PE=2 SV=1 226 405 4.0E-08
sp|Q9XW42|ANM7_CAEEL Protein arginine N-methyltransferase 7 OS=Caenorhabditis elegans GN=prmt-7 PE=1 SV=2 240 350 4.0E-08
sp|Q9SI54|LSM7_ARATH Sm-like protein LSM7 OS=Arabidopsis thaliana GN=LSM7 PE=1 SV=1 589 652 6.0E-08
sp|B4JWL5|ANM7_DROGR Protein arginine N-methyltransferase 7 OS=Drosophila grimshawi GN=Art7 PE=3 SV=1 195 572 3.0E-07
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 236 341 5.0E-07
sp|B0X4N1|ANM7_CULQU Protein arginine N-methyltransferase 7 OS=Culex quinquefasciatus GN=Art7 PE=3 SV=1 236 354 9.0E-07
sp|Q0W8R9|RUXX_METAR Putative snRNP Sm-like protein OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=UNCMA_29510 PE=3 SV=1 587 662 9.0E-07
sp|Q8LFL8|LSM1B_ARATH Sm-like protein LSM1B OS=Arabidopsis thaliana GN=LSM1B PE=1 SV=1 579 652 1.0E-06
sp|B3MF31|ANM7_DROAN Protein arginine N-methyltransferase 7 OS=Drosophila ananassae GN=Art7 PE=3 SV=1 195 347 2.0E-06
sp|A2Y8B9|ANM7_ORYSI Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. indica GN=PRMT7 PE=3 SV=3 214 360 2.0E-06
sp|Q5VS72|ANM7_ORYSJ Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. japonica GN=PRMT7 PE=2 SV=1 214 360 2.0E-06
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 236 312 3.0E-06
sp|Q9UK45|LSM7_HUMAN U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens GN=LSM7 PE=1 SV=1 588 652 3.0E-06
sp|A6TSL8|PRMA_ALKMQ Ribosomal protein L11 methyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=prmA PE=3 SV=1 240 344 5.0E-06
sp|B7GKD0|PRMA_ANOFW Ribosomal protein L11 methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=prmA PE=3 SV=1 240 344 7.0E-06
sp|O29386|RUXX_ARCFU Putative snRNP Sm-like protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0875 PE=1 SV=1 595 662 7.0E-06
sp|P53905|LSM7_YEAST U6 snRNA-associated Sm-like protein LSm7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSM7 PE=1 SV=2 594 664 7.0E-06
sp|Q9CQQ8|LSM7_MOUSE U6 snRNA-associated Sm-like protein LSm7 OS=Mus musculus GN=Lsm7 PE=1 SV=1 588 652 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|100060
MSNTPTDAKPTQDLGRKEDDCSTCSSSTGDDDDQNWDDWGSDSHEKQECPSLFDDAKLPSAAEALAYDKEKFGFD
LDQVCSVLGLDFHKRVRLVNFLRKNKFSAQKALELTGQEPWFSSDEYLVPVLENDGLLQVLLSDDWSDDDALDGN
LEKKIQMLENDLALAQQSLLEHRNYVKQRLDLPTTEEAGPSQTVRDDDKHYFDSYAENDIHAVMIQDQVRTSSYA
HFILKNPNLFRDAIVLDVGCGTGILSLFAARSGAKRVIAVDASEIAEKAKKIVKANDFEDTITVIQGKVENVVLP
DGISQVDIIISEWMGYALLYESMLDSVLVARDRFLRAGGVMAPSQCKMMIALCDAREIYKDRIGFWDDVYGFDLS
EMSKGLCDEAIVDVVGPETLASDPYAVKDLVLGEITIRQLEFETDFILKSTVDKRTKINSFVLYFDTFFNRLGQP
ISPETEVKFIQKGDPVLAEIWPVGGKSAQKRRQSLGPDREDTDSFSTGPQSMPTHWKQTIFMLPEPITVVGDSTV
TGSFWLRKRENNSRELDVEIHYAVKLNAETPATEPVVRNNDVKCISCIAVVLVESVLLSTTMSKASQPELKKYMD
KKLFVHLQGGRKVSGTLRGYDLFLNLVIDDAIEETTPAQKHPIGQVVIRGNSGFDTVFYSFPCALRATKIVFLIC
Y*
Coding >AgabiH97|100060
ATGAGCAACACACCCACAGACGCCAAACCTACACAGGATCTCGGAAGAAAAGAAGATGATTGCTCAACATGTTCA
TCTTCCACGGGAGACGACGACGATCAAAATTGGGATGACTGGGGCTCCGACTCGCATGAAAAACAGGAATGCCCT
TCTTTATTTGATGACGCTAAGCTTCCTAGCGCAGCAGAAGCTTTGGCATATGACAAGGAAAAATTTGGTTTCGAT
CTTGACCAGGTGTGCAGTGTGTTAGGGCTCGATTTCCATAAACGCGTTCGATTGGTCAACTTCCTCAGGAAAAAT
AAATTTTCAGCACAAAAAGCATTGGAGTTGACTGGACAAGAACCCTGGTTTTCTTCTGATGAGTATTTGGTACCA
GTTCTAGAAAATGATGGGCTTTTGCAGGTTTTGTTATCGGATGACTGGTCCGACGATGATGCGTTGGATGGGAAC
CTTGAGAAGAAAATCCAAATGCTCGAGAATGACTTGGCCTTGGCTCAACAAAGTCTTCTAGAACACAGAAATTAC
GTCAAGCAAAGGCTCGACCTACCCACCACTGAGGAGGCGGGCCCCTCACAGACGGTTCGCGATGACGACAAACAT
TATTTCGATAGCTACGCCGAGAATGATATACATGCGGTTATGATTCAGGACCAAGTGCGAACCTCTTCATACGCG
CATTTCATTTTAAAAAATCCCAACCTGTTTCGAGACGCAATAGTTCTCGACGTAGGATGTGGCACCGGAATTCTA
TCCCTCTTCGCCGCAAGAAGTGGGGCCAAACGCGTAATTGCAGTAGATGCTAGCGAAATTGCCGAGAAAGCTAAA
AAGATTGTCAAGGCCAATGATTTTGAGGATACCATTACAGTAATCCAAGGGAAGGTTGAAAACGTTGTACTACCG
GATGGTATTTCGCAAGTGGATATTATCATATCCGAGTGGATGGGTTATGCGTTGCTCTACGAGTCCATGCTTGAT
TCAGTCCTGGTCGCTCGGGATCGGTTCCTTCGCGCCGGTGGTGTTATGGCCCCGAGTCAATGCAAAATGATGATT
GCACTCTGCGATGCAAGAGAGATATATAAAGATCGTATTGGCTTCTGGGATGACGTATATGGATTTGATCTGTCT
GAAATGTCTAAAGGTCTATGCGATGAGGCGATTGTAGATGTTGTCGGCCCCGAGACTCTGGCAAGTGATCCATAC
GCCGTGAAGGACCTTGTCCTTGGGGAGATCACCATTCGACAACTCGAGTTCGAAACTGACTTCATTCTCAAATCC
ACGGTGGATAAACGAACAAAAATCAACTCTTTCGTGCTTTACTTTGACACCTTTTTCAACCGCTTGGGGCAACCC
ATATCGCCCGAGACTGAAGTCAAGTTCATTCAAAAGGGAGATCCCGTCCTTGCGGAGATTTGGCCAGTAGGAGGA
AAATCCGCTCAGAAGCGGAGGCAGAGTTTGGGCCCGGATAGAGAGGATACTGACAGTTTCAGCACTGGCCCTCAG
AGTATGCCGACGCATTGGAAGCAGACAATATTTATGCTCCCTGAACCCATTACCGTCGTAGGAGATTCTACTGTG
ACAGGATCATTCTGGCTTCGTAAAAGAGAGAACAATTCACGAGAGCTGGACGTGGAAATTCATTATGCAGTCAAA
CTGAACGCAGAAACGCCGGCAACAGAGCCGGTTGTCCGAAACAACGATGTCAAGTGTATCAGCTGCATTGCGGTC
GTTTTAGTTGAATCGGTGTTGTTATCCACTACCATGTCGAAAGCATCTCAACCCGAACTCAAGAAGTATATGGAC
AAAAAGCTCTTCGTCCACCTTCAGGGTGGTCGAAAAGTCAGCGGGACACTTCGTGGATATGATCTCTTCTTGAAT
CTTGTCATCGATGACGCCATTGAAGAAACCACCCCTGCCCAAAAGCATCCGATCGGTCAGGTCGTCATACGTGGA
AATAGTGGGTTTGATACAGTGTTCTATAGTTTTCCTTGTGCTCTGAGGGCAACCAAAATTGTATTTCTAATCTGT
TATTGA
Transcript >AgabiH97|100060
ATGAGCAACACACCCACAGACGCCAAACCTACACAGGATCTCGGAAGAAAAGAAGATGATTGCTCAACATGTTCA
TCTTCCACGGGAGACGACGACGATCAAAATTGGGATGACTGGGGCTCCGACTCGCATGAAAAACAGGAATGCCCT
TCTTTATTTGATGACGCTAAGCTTCCTAGCGCAGCAGAAGCTTTGGCATATGACAAGGAAAAATTTGGTTTCGAT
CTTGACCAGGTGTGCAGTGTGTTAGGGCTCGATTTCCATAAACGCGTTCGATTGGTCAACTTCCTCAGGAAAAAT
AAATTTTCAGCACAAAAAGCATTGGAGTTGACTGGACAAGAACCCTGGTTTTCTTCTGATGAGTATTTGGTACCA
GTTCTAGAAAATGATGGGCTTTTGCAGGTTTTGTTATCGGATGACTGGTCCGACGATGATGCGTTGGATGGGAAC
CTTGAGAAGAAAATCCAAATGCTCGAGAATGACTTGGCCTTGGCTCAACAAAGTCTTCTAGAACACAGAAATTAC
GTCAAGCAAAGGCTCGACCTACCCACCACTGAGGAGGCGGGCCCCTCACAGACGGTTCGCGATGACGACAAACAT
TATTTCGATAGCTACGCCGAGAATGATATACATGCGGTTATGATTCAGGACCAAGTGCGAACCTCTTCATACGCG
CATTTCATTTTAAAAAATCCCAACCTGTTTCGAGACGCAATAGTTCTCGACGTAGGATGTGGCACCGGAATTCTA
TCCCTCTTCGCCGCAAGAAGTGGGGCCAAACGCGTAATTGCAGTAGATGCTAGCGAAATTGCCGAGAAAGCTAAA
AAGATTGTCAAGGCCAATGATTTTGAGGATACCATTACAGTAATCCAAGGGAAGGTTGAAAACGTTGTACTACCG
GATGGTATTTCGCAAGTGGATATTATCATATCCGAGTGGATGGGTTATGCGTTGCTCTACGAGTCCATGCTTGAT
TCAGTCCTGGTCGCTCGGGATCGGTTCCTTCGCGCCGGTGGTGTTATGGCCCCGAGTCAATGCAAAATGATGATT
GCACTCTGCGATGCAAGAGAGATATATAAAGATCGTATTGGCTTCTGGGATGACGTATATGGATTTGATCTGTCT
GAAATGTCTAAAGGTCTATGCGATGAGGCGATTGTAGATGTTGTCGGCCCCGAGACTCTGGCAAGTGATCCATAC
GCCGTGAAGGACCTTGTCCTTGGGGAGATCACCATTCGACAACTCGAGTTCGAAACTGACTTCATTCTCAAATCC
ACGGTGGATAAACGAACAAAAATCAACTCTTTCGTGCTTTACTTTGACACCTTTTTCAACCGCTTGGGGCAACCC
ATATCGCCCGAGACTGAAGTCAAGTTCATTCAAAAGGGAGATCCCGTCCTTGCGGAGATTTGGCCAGTAGGAGGA
AAATCCGCTCAGAAGCGGAGGCAGAGTTTGGGCCCGGATAGAGAGGATACTGACAGTTTCAGCACTGGCCCTCAG
AGTATGCCGACGCATTGGAAGCAGACAATATTTATGCTCCCTGAACCCATTACCGTCGTAGGAGATTCTACTGTG
ACAGGATCATTCTGGCTTCGTAAAAGAGAGAACAATTCACGAGAGCTGGACGTGGAAATTCATTATGCAGTCAAA
CTGAACGCAGAAACGCCGGCAACAGAGCCGGTTGTCCGAAACAACGATGTCAAGTGTATCAGCTGCATTGCGGTC
GTTTTAGTTGAATCGGTGTTGTTATCCACTACCATGTCGAAAGCATCTCAACCCGAACTCAAGAAGTATATGGAC
AAAAAGCTCTTCGTCCACCTTCAGGGTGGTCGAAAAGTCAGCGGGACACTTCGTGGATATGATCTCTTCTTGAAT
CTTGTCATCGATGACGCCATTGAAGAAACCACCCCTGCCCAAAAGCATCCGATCGGTCAGGTCGTCATACGTGGA
AATAGTGGGTTTGATACAGTGTTCTATAGTTTTCCTTGTGCTCTGAGGGCAACCAAAATTGTATTTCTAATCTGT
TATTGA
Gene >AgabiH97|100060
ATGAGCAACACACCCACAGACGCCAAACCTACACAGGATCTCGGAAGAAAAGAAGATGATTGCTCAACATGTTCA
TCTTCCACGGGAGACGACGACGATCAAAATTGGGATGACTGGGGCTCCGACTCGCATGAAAAACAGGAATGCCCT
TCTTTATTTGATGACGCTAAGCTTCCTAGCGCAGCAGAAGCTTTGGCATATGACAAGGAAAAATTTGGTTTCGAT
CTTGACCAGGTGTGCAGTGTGTTAGGTGCGCCAACCAATATTTCTTTCCGCAGTTCACACAAATTGAGAATACAG
GGCTCGATTTCCATAAACGCGTTCGATTGGTCAACTTCCTCAGGAAAAATGTATGCTGCGGTTTGAGAAGTTCAG
GGAGTATGACCTCACATCAAATCGTAGAAATTTTCAGCACAAAAAGCATTGGAGTTGACTGGACAAGAACCCTGG
TTTTCTTCTGATGAGTATTTGGTACCAGTTCTAGAAAATGATGGGCTTTTGCGTGAGTCTCGGCCACTCGAAAAT
CTCGACCGATGTAGATTGTCTGAAGAAATTTTTCAGAGGTTTTGTTATCGGATGACTGGTCCGACGATGATGCGT
TGGATGGGAACCTTGAGAAGAAAATCCAAATGCTCGAGAATGACTTGGCCTTGGCTCAACAAAGTCTTCTAGAAC
ACAGAAATTACGTCAAGCAAAGGCTCGACCTACCCACCACTGAGGAGGCGGGCCCCTCACAGACGGTTCGCGATG
ACGACAAACATTATTTCGATAGCTACGCCGAGAATGGTGCGCCACCAGAACAAAAATGCTATTAAAGTTGTTAAT
GTATTGTTTAATCCACCCTCAGATATACATGCGGTTATGATTCAGGACCAAGTGCGAACCTCTTCATACGCGCAT
TTCATTTTAAAAAATCCCAACCTGTTTCGAGACGCAATAGTTCTCGACGTAGGATGTGGCACCGGAATTCTATCC
CTCTTCGCCGCAAGAAGTGGGGCCAAACGCGTAATTGCAGTAGATGCTAGCGAAATTGCCGAGAAAGCTAAAAAG
ATTGTCAAGGCCAATGATTTTGAGGATACCATTACAGTAATCCAAGGGAAGGTTGAAAACGTTGTACTACCGGAT
GGTATTTCGCAAGTGGATATTATCATATCCGAGTGGATGGGTTATGCGTTGCTCTACGAGTCCATGCTTGATTCA
GTCCTGGTCGCTCGGGATCGGTTCCTTCGCGCCGGTGGTGTTATGGCCCCGAGTCAATGCAAAATGATGATTGCA
CTCTGCGATGCAAGAGAGATATATAAAGATCGTATTGGCTTCTGGGATGACGTATATGGTGAGCCCGCAATAATA
GGAAATGCCCATGCGAGATTGATATATCTGAATATTAGGATTTGATCTGTCTGAAATGTCTAAAGGTCTATGCGA
TGAGGCGATTGTAGATGTTGTCGGCCCCGAGACTCTGGCAAGTGATCCATACGCCGTGAAGGTCGGTTTATGATA
GCTCGTCGATGCCCCTTTCGCCTTGCAATTAACATACTCCGCAGGACCTTGTCCTTGGGGAGATCACCATTCGAC
AACTCGAGTTCGAAACTGACTTCATTCTCAAATCCACGGTGGATAAACGAACAAAAATCAACTCTTTCGTGCTTT
ACTTTGACACCTTTTTCAACCGCTTGGGGCAACCCATATCGCCCGAGACTGAAGTCAAGTTCATTCAAAAGGGAG
ATCCCGTCCTTGCGGAGATTTGGCCAGTAGGAGGAAAATCCGCTCAGAAGCGGAGGCAGAGTTTGGGCCCGGATA
GAGAGGATACTGACAGTTTCAGCACTGGCCCTCAGAGTATGCCGACGCATTGGAAGCAGACAATATTTATGCTCC
CTGAACCCATTACCGTCGTAGGAGGTGCGTTCACTGGGAACATATCTGTAGGCAGTGAGCTAATTTATGGAGTAG
ATTCTACTGTGACAGGATCATTCTGGCTTCGTAAAAGAGAGAACAATTCACGAGAGCTGGACGTGGAAATTCATT
ATGCAGTCAAACTGAACGCAGAAACGCCGGCAACAGAGCCGGTTGTCCGAAAGTACACAGTTCGATAGTAGTTAG
GTTTACAAGTTTGATTGCATGTTGATAACTCGAACATTGAAAGGCAGCAACGATGTCAAGTGTATCAGCTGCATT
GCGGGTATGCAGGGTGACGCGCTGTGACAGTATATCACGTGATTACTATGAGCGTTTTTCAGTCGTTTTAGTTGA
ATCGGTGTTGTTATCCACTACCATGTCGAAAGCATCTCAACCCGAACTCAAGAAGGTAAGATCACATTTGATGAG
CGCTCTACAGTTTGACGTTTAAACCTTTGCTCTTGTCTATAGTATATGGACAAAAAGCTCTTCGTCCACCTTCAG
GGTGGTCGAAAAGTCAGCGGGACACTTCGTGGATATGATCTCTTCTTGAATCTTGTCATCGATGACGCCATTGAA
GAAACCACCCCTGCCCAAAAGCATCCGATCGGTCAGGTCGTAAGTTGACTTGTTGGTATAAAACGTAATTCCTCT
CATCTGACTCTTCTCCAGGTCATACGTGGAAATAGTGTAACGTCGATGGAAACACTAGAAGCTATACGGCCTTGA
TCTCTATGTCTGTCTGCGGAGGGGTTTGATACAGTGTTCTATAGTTTTCCTTGTGCTCTGAGGGCAACCAAAGTG
CGTTCGCTATCAAATCCACTCAGGAACTAGGTTGATCAGGGCCTTGTTAGATTGTATTTCTAATCTGTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail